KEGG   Listeria monocytogenes M7: LMM7_1020Help
Entry
LMM7_1020         CDS       T01988                                 

Gene name
btuE
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmq  Listeria monocytogenes M7
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LMM7_1020 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LMM7_1020 (btuE)
Enzymes [BR:lmq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LMM7_1020 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1011673..1012152
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVELFPSKMKPADFEDKVEALVAKVSK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaatggcaaagaaatagctttaagtgat
tataaaggcaaggtattacttatcgtgaatacagcgagcaaatgtggcttaacacctcag
cttgaaggcctagaagccatgtataaaaaattgggtggcgctaattttgaaattctcggt
ttcccatgtaaccagtttttacgtcaagatcctgggagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgacgttccaaatgttctctaaaattaaagtgaaaggcaaa
gacgccagcccgctttataaatatttaaccgaacaaactggtggtaaaaaagtagaatgg
aattttgcgaaattcttaattgatgaaaatggcgaagtggttgaacttttcccatcaaaa
atgaaaccagcagattttgaggataaagtggaagcacttgttgcgaaagtaagtaaataa

DBGET integrated database retrieval system