KEGG   Listeria monocytogenes M7: LMM7_1108Help
Entry
LMM7_1108         CDS       T01988                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmq  Listeria monocytogenes M7
Pathway
lmq00040  Pentose and glucuronate interconversions
lmq00052  Galactose metabolism
lmq00500  Starch and sucrose metabolism
lmq00520  Amino sugar and nucleotide sugar metabolism
lmq01100  Metabolic pathways
lmq01130  Biosynthesis of antibiotics
Module
lmq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMM7_1108 (galU)
   00052 Galactose metabolism
    LMM7_1108 (galU)
   00500 Starch and sucrose metabolism
    LMM7_1108 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LMM7_1108 (galU)
Enzymes [BR:lmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LMM7_1108 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Smr
Motif
Other DBs
NCBI-ProteinID: AEH92113
UniProt: A0A0E0UVG9
Position
complement(1097264..1098151)
Genome map
AA seq 295 aa AA seqDB search
MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGK
RAIEDHFDSVPELELNLREKNKLELLHLIEETTNINLHFIRQSKPKGLGDAILQARGFVG
NEPFIVMLGDDIVQAKTPCAKQLIDQYEKTHSSIIGVQTVPHEETYRYGIIDPIDEYSKN
LYNVNGFVEKPDPSAAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQ
RVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDVALLVDELYAEIHLKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaagcagtcattccagcagcaggattagggacgagatttctgcctgcc
acaaaagcaatgcctaaagaaattcttccaatagtagacaagccaaccattcaatacata
gtagaagaagcagtagaatctggaattgaagatattctaattgttactggtaaagggaaa
agagctattgaagatcactttgactctgtaccagaacttgagctcaatctacgtgaaaaa
aacaaactagaattacttcatttaattgaagaaacaacaaatattaatctgcattttatt
cgtcaatcgaaacctaaaggacttggtgatgccatcttacaagcaagaggttttgttggt
aacgaaccatttatcgttatgttgggcgatgacattgtacaagcaaaaacaccatgtgca
aaacaactaatagatcaatatgaaaaaacacatagttcaatcattggagttcaaacggtt
cctcatgaagaaacttatcgttacggcattatcgatccaattgatgaatatagtaaaaat
ctgtacaatgtaaatggttttgtcgaaaagcctgatccaagtgcggcaccatctgacctt
gctattctgggtagatatctactaacacctcagatttttgactttctagaaacacaaaaa
cctggtgctggtggggaaatccaactaaccgacgcaatcaacagtttaaatgagattcag
cgtgtgttcgcttatgatttcgaaggagaacgttttgatgttggcgataaatttggtttt
attaagacgaccatgcaatttgctttaaaacatccggaaattaaagacgatgttgctctc
ttagtagatgaattatatgctgaaattcacttgaaggataaaaaataa

DBGET integrated database retrieval system