KEGG   Listeria monocytogenes M7: LMM7_1292Help
Entry
LMM7_1292         CDS       T01988                                 

Definition
hypothetical protein
Organism
lmq  Listeria monocytogenes M7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1249768..1253772
Genome map
AA seq 1334 aa AA seqDB search
MNKLQGLSINLDLDATRVDEGMKGLKRTLGSVNSEMKANLSAFGKGEKTLSRYETELDGL
NKKLSVQSKMVSQTKNDFKDLEKRNASLNGELKESNKTLTESKKRFEQLSKSGNATEKEL
KEAEKEVNSNQKSYNKLNKELQQMPKALAAGEKAVNNEVANYNNLQRKIDTTTESYKKFK
REQAVKSSPWGAVTQDLDKYQKKLNETGDKLVAFGKKGSLYMAPVALGLGFATKKAADFE
QQMSNTLSVMSPGEVNEYKDALRELAIQQGADTKYSALEAAQAQEELLKAGLSVKDVING
GLSGALSLATAGELDLASAAEIAATVLNAFKDDNLSVADAANILAGAANASATGVEEMKM
SLQQVSAVASGVGLSFDDTSTMLAVFAQNGLKGSDAGTSLKTMLQRLHPTTKAAWQQFDA
LGLSIVDNETAMKVLQENGVKPLSNDTDKLMGQIQDLAKSLAGPKASASKVNKEFEELTV
ATGAVHSAFYDTNGELKSAEEISGLLQSSLKDLNSEQRSAALGAMFGSDAVRAGNIAYRE
GADGIKKMRTEMGKVTADDVAKMKMDNLKGTIEEISGAIETFAISIGTSLTPVLRGLGKY
IQKAADWFNGLNDSTKTVISTAGVVAVAIPVAGLAFGFIAKGAAAAISPVKKLTAALAEN
SVAAGTNAATTQLAGNALPVAGGKGKGFLGKAGSFFKGSKGTKALSTADMAGDIASYSKF
GKIGAGLKGLGKVLPGIGIALSASQLIGINKKNAGDKAGSAGGSLAGGAAGAAIGTAIAP
GIGTAIGAAVGGIAGTKFGQAFGKKVQKEFPEYQQKFVNMWDGLSDSAKKHPILLAPVNQ
INDQIKMAKAGYAAIKDVFANPLKTDISGKGISKDTAKNVNSYKTMSQNAISELKYLEMS
GDVITKSTSAKISKNYNGMVVLVEKSFEKTKKSSDKNLNTLSKNSMLSEADIKAVKEKQA
KIQKLSLDEVKKNNEKIQKLNKDMAAKNADITKKEKADIKAINDKAAKEGRVLTASEEQQ
ITSIKRNAANQRKASNQSYSNQIQTIAKKQETAVVSSLSKSAKEQKLILGKLKDSSGKLS
TEQASKVVSESKRAKDEAVKEANKKYKDVVAAADKEYYVNGTITKKQHDDIVKKARSQKN
KTVKAATEMHEQVVSQAQSQATGHLNQVDWETGQSLSKWDNFKVNLAGVINSVTGGINKV
LKFFSLPTIPEWKPKGYNNDTKKINTSKRTSYGSNLAMDYTGSNNASGQIMAGEEGFEIA
YNKRKAQAQILGANGAEITHVAPGTKILNHADSKKVMQGGLGKTLPGFANGNSSINDFLS
DAWDGTKSCSWESS
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttcaaggattgtcgattaacctagacctagatgctactagagtggacgag
ggaatgaaagggttgaagcggaccctcggctctgtgaacagcgaaatgaaagcgaatctt
tcggcgtttggtaagggagaaaaaaccttatctcgttatgaaacagagctagatggtctt
aataaaaagttatctgttcaaagcaaaatggtttctcaaactaaaaacgattttaaagat
ttagaaaaacgaaatgcttctttaaatggagagttgaaagagtctaataaaacgttaact
gagtcaaaaaaacgttttgaacagctttctaaatctggcaatgcaactgaaaaagaatta
aaagaagcggaaaaagaagtcaactcaaatcaaaaatcgtataacaaacttaacaaagaa
ctacaacaaatgccaaaagctttagcagcaggggaaaaagcagtaaataatgaagttgca
aattacaataatttgcaaagaaagattgatactaccacagaatcttataagaaattcaag
agagagcaagctgttaaaagctcaccgtggggagcagtgactcaagatttagacaagtat
caaaaaaagttaaatgagacaggagataaacttgtcgctttcggtaaaaaaggcagtttg
tacatggctccagttgcgcttggtttaggtttcgcaacaaaaaaagcggcagactttgag
caacaaatgtcgaacactttatctgtcatgtctcctggtgaggtaaatgaatataaagat
gctttaagagaacttgctattcaacaaggtgcggatacgaaatactccgcattagaagcc
gcacaggcacaagaagaacttttaaaggcaggtctttcagttaaagatgttataaatggc
ggattgtctggagcgctttcattagcaacagctggcgagttagatttagcgtcagcggca
gaaattgcagctacagttttaaatgcgttcaaggatgataatttgagcgtggcggatgcg
gcaaacattctagctggtgcagcaaatgcttctgccacaggtgtagaagaaatgaagatg
tctttacaacaagtttctgctgttgccagtggcgttggtctctcatttgacgatacatca
acaatgttagcagtatttgcgcagaatggtttaaaaggttctgatgcaggtacctctcta
aaaacgatgctacaaaggttgcatcctacaacaaaagcggcatggcaacaatttgatgct
cttgggttaagcattgtggacaatgaaactgctatgaaagtattgcaagaaaatggtgtt
aaaccactctcgaatgatacagataaattaatgggacaaattcaagatttagctaaaagt
ttggcaggtccaaaggcaagtgcttctaaagttaacaaagaatttgaagaattgaccgtt
gccactggcgcagtccactccgcgttttatgatacaaacggggaattaaaatcagcagaa
gaaatatctggtctattgcaaagcagtctaaaagatttgaactccgaacagcgtagtgca
gcgctaggtgctatgtttggctccgatgcagttcgtgctgggaatattgcttatcgtgaa
ggcgcggatggaataaagaaaatgcgcactgaaatgggaaaagtaactgctgatgacgta
gctaaaatgaaaatggataatctgaaaggtactattgaagaaatttctggtgcaattgag
acctttgctatcagcattggaacatcattgactccggtattacgtggtctaggaaagtac
attcaaaaagcagctgattggtttaatggtttgaatgatagtactaaaacggttatctct
acagcaggtgtagttgcggtagcgattccggttgctggactagcatttggatttattgca
aaaggggcagcggctgctatctcacctgtaaagaaattaacagcagcgttagcagaaaac
tctgttgctgctggaactaatgcagcgactacgcaacttgctggaaacgctttgccggta
gctggagggaaaggtaaaggtttcttaggtaaagctggctcgttttttaaaggaagcaaa
ggaacaaaagcgctatctacggctgatatggctggtgatattgcgagttatagcaaattc
ggaaaaattggggctggtttgaaaggattaggcaaggtattacccggcattgggatagcc
ttatccgctagtcaattgattggtattaataaaaaaaatgcaggggataaagctggtagt
gctggcggaagtttagcgggaggcgcagctggtgcggcaatcggaacagcaattgctcct
ggaatcggaaccgcgataggtgcggcagttggaggcatagcgggaacgaaatttggtcag
gcattcggtaagaaagttcaaaaagaatttccagaatatcaacagaaatttgtaaatatg
tgggatggattgtcagattctgctaaaaaacatcctatactattagcacctgttaatcaa
attaacgatcaaattaaaatggcgaaagcaggatatgcggctataaaagatgtgtttgct
aatcctttgaaaacggatatttccggaaaaggtattagtaaagatacagcaaaaaatgta
aattcttataaaactatgtctcaaaacgcaatctctgaattgaagtatttagaaatgtct
ggggatgtaatcactaaatcaacatctgctaaaattagcaaaaattataatgggatggtt
gtactagtcgagaaatcttttgagaagactaaaaaaagttctgataagaatttaaatact
ttgtcaaagaatagcatgttatcagaagcagacataaaagcggttaaagagaagcaagca
aaaatacaaaaattgtcattagatgaagtgaagaaaaacaacgaaaaaatccagaaatta
aataaagacatggcggccaaaaatgcagatattactaaaaaggaaaaagcggatataaaa
gctattaacgacaaagcggcaaaagaaggcagagttttaaccgcttcagaggaacagcaa
attacgagcatcaaacgtaatgctgcaaatcaacgaaaagctagtaatcaaagttatagc
aatcaaatacaaacaattgctaaaaaacaagaaacagcagtggttagttctttgagtaag
tctgcaaaagagcaaaaattaattttaggaaaactgaaagacagtagtgggaaattaagt
acagaacaagcttcaaaagtggttagcgaatcgaagagagcaaaagatgaagcagtaaaa
gaagctaacaagaaatataaggatgtagttgctgctgctgacaaagaatattatgtgaat
ggaactattacgaaaaagcaacatgatgatattgtaaaaaaagctaggagccaaaagaat
aaaaccgtaaaagcggcaactgaaatgcatgaacaagtagtcagtcaagctcaatcacaa
gctactggtcatttaaaccaagttgactgggaaacaggtcaatcattatcgaaatgggat
aattttaaagttaatttagcgggtgtgattaactctgtcaccggtggaataaataaagta
ttaaaattctttagtttacctaccataccagaatggaagccaaaaggttataataatgac
acaaaaaaaataaatactagcaaaagaacttcctacggtagtaaccttgcaatggattac
acaggttctaataatgcatccggacaaattatggctggcgaagaaggatttgagattgca
tataataaacgcaaagcacaagcacaaattttaggtgcaaatggtgcagaaataacgcat
gttgcgccaggtactaaaattttgaatcatgcagattcaaaaaaagtcatgcaaggcgga
cttggtaaaacattgcctggctttgcgaatgggaattcatccattaatgattttttaagt
gacgcatgggatggaacaaaaagctgtagctgggaaagtagttga

DBGET integrated database retrieval system