KEGG   Listeria monocytogenes M7: LMM7_1424Help
Entry
LMM7_1424         CDS       T01988                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmq  Listeria monocytogenes M7
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMM7_1424 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMM7_1424 (glk)
   00052 Galactose metabolism
    LMM7_1424 (glk)
   00500 Starch and sucrose metabolism
    LMM7_1424 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LMM7_1424 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMM7_1424 (glk)
   00524 Butirosin and neomycin biosynthesis
    LMM7_1424 (glk)
Enzymes [BR:lmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMM7_1424 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1380252..1381220
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWAEEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagataaaggt
gcccacattgttaaaaatattggcgactctatcaatcaaaaattaacagatttacaacta
gataatgatattttttacggtattggaatgggaaccccagggactgttaattatgaaact
ggtacagtcaaaggtgcttataacctaggttgggctgaagaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgctgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattggccatgtaacagtagttccggaaaacggttatgactgtacttgtggt
aaaaagggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatacaggtaaatctgcgcttaaagatgcaataaacaacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaacc
attgataaaatttctttctatttggcattagcgcttagtcacattggtaatatgttaaat
ccagagaaaattattatcggcggtggagtttcagcggctggcgaccaattattaacacca
gtaaaaacttattttgagacaatggttttcccggcggttaaagaatctactaaattatct
attgcgacaaaagggaatgacgcagggataatcggagccgcatggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system