KEGG   Listeria monocytogenes M7: LMM7_1619Help
Entry
LMM7_1619         CDS       T01988                                 

Gene name
ruvA
Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmq  Listeria monocytogenes M7
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1581701..1582306)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEEDLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgtcgag
gcaggacaaatcggctatcaaataattacaggaaacccgttttcctttcaacgattagaa
ggtacagaagcgcaagtctttttgtatcaacatgtgcgggaggataatatttctctattc
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcgttagctattattgcttcaggcgatgtcgttccactgatttctgct
attgaatccgaagacgatgtttatttaaccaaatttccaagtgttggtaaaaaaacagcg
cgccaaatcattctcgatttgaaaggcaagctggctgatgttgttgcaagtgaaattgtt
tatgttgcaccagaaaatgatatggttgctggactttctccgcaattagaagaagctgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gcaaaagaagaagacctaacaagcgacgcatatatcaagctagcactacaattaatgaca
aaatag

DBGET integrated database retrieval system