KEGG   Listeria monocytogenes M7: LMM7_1624Help
Entry
LMM7_1624         CDS       T01988                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmq  Listeria monocytogenes M7
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lmq00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1586632..1588125)
Genome map
AA seq 497 aa AA seqDB search
MEKKYILALDQGTTSSRAMIIDEEGEVIGVAQEEFDQIFPKPGWVEHNANEIWASILAVI
AGVLLKTNISSKEIAGIGITNQRETTVIWDKESGNPIYNAIVWQSRQTEDICKQLRKDGY
EDTIRSKTGLLIDPYFAGTKARWILDHVDGAQERAEKGELLFGTIDTWLVWKLTGGRAHI
TDYSNASRTLLYNIYDLEWDDELLKMLNIPRAMLPEVRPSSEVYADTVPYHFFGEEVPVA
GIAGDQQAALFGQGCFEKGMAKNTYGTGCFLLMNTGEKAVRSENGLLTTLAWGIDGKVEY
ALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESSDGVYVVPAFVGLGAPYWDSDV
RGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGISLKTLRVDGGASANNFLMQ
FQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKNEIKKHWKLDKRFEVEMKDEQRE
DLYEGWHKAVKAAQAFK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatatattttagcactggatcaaggaacaacgagttcaagagcgatgatt
attgatgaagaaggagaagttattggcgttgcacaagaagaatttgatcaaatttttcct
aagccaggctgggtagaacataatgccaatgaaatctgggcatcgattttagctgtaatt
gcaggcgtattactcaaaacaaatatttcttctaaagaaattgcggggattggtattaca
aaccaacgtgaaactactgttatttgggataaagaaagcggaaatccaatctataatgcg
attgtttggcaatctcgtcaaactgaagatatttgtaaacaattacgtaaagatggctat
gaagatactattcgttctaaaactggtcttttaatcgatccatactttgcgggtacaaaa
gctcgctggattttggatcatgtggatggcgcacaagaacgtgctgaaaaaggagaactt
ctttttggaacgattgatacgtggctagtctggaaattaactggtggtcgtgctcatatt
accgactattccaatgcttctcggacacttctttataatatttatgatttagaatgggat
gatgagcttctaaaaatgcttaatatcccaagagcaatgttacctgaagttcgtccttcc
tctgaagtgtatgcagatacagtgccttatcacttctttggcgaagaagttccggttgca
ggtattgctggtgaccaacaagccgctttattcggacaaggttgttttgaaaaagggatg
gcgaaaaatacttacggaactggttgtttcttactcatgaacacgggagaaaaagctgta
cgttctgaaaatggtctattaacgacacttgcttggggtattgatggcaaagtagaatat
gcacttgaaggtagtattttcgttgctggttctgctattcagtggttacgtgatggcttg
cgtatggttcgtcaatcaagtgattctgaaaactatgcaagtcgaattgaatcaagtgac
ggtgtgtacgtagtgccggcgttcgttggtttaggtgcgccttactgggattcagatgtt
cgtggagctgtatttggattaactcgtggtacagaaaaagaacaatttatccgtgcaaca
ttggaatctcttgcctatcaaacaagagacgtactttatgcaatggaacaagattctggt
attagcttaaaaacattacgcgtggatggcggggcttctgctaataatttcttaatgcaa
ttccaatccgatattctaggtgttccagtagagcgcccagaaaacaaagaaacaactgta
ctaggagcagctttcttagcaggtctggcagttggtgtttggaaagacaagaacgaaatt
aaaaaacattggaaactagataaacgttttgaagtagaaatgaaagatgaacaaagagaa
gatttatatgaaggttggcataaagctgtcaaagctgcacaagcctttaaataa

DBGET integrated database retrieval system