KEGG   Listeria monocytogenes M7: LMM7_1641Help
Entry
LMM7_1641         CDS       T01988                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthetase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmq  Listeria monocytogenes M7
Pathway
lmq00860  Porphyrin and chlorophyll metabolism
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMM7_1641 (hemD)
Enzymes [BR:lmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LMM7_1641 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 ANF_receptor
Motif
Other DBs
NCBI-ProteinID: AEH92646
UniProt: A0A0E0UWA7
Position
complement(1604729..1605451)
Genome map
AA seq 240 aa AA seqDB search
MNKKVVLTREASKNQPWQTYFGQNGFAVVSVPLIKTRPKKISLSREQLEAEWLFLTSANA
VEYFFMNQPGEAHYKIAVIGEKTREKLAEFGYKPSFVPSIYQSEIFLEEWLNENPEKTSV
LLPQSNLSRSIIKDTLTEKGYLVHSVELYETVSPENSKIKLTELLNSNDIHIIIFASPSA
WKNFYSIAKSLPVQKEKWHIASIGSITTEAILADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagttgttttaacaagagaggcgagcaaaaatcaaccttggcaaacctat
ttcgggcaaaacggttttgcagtggtgtccgttccgttaattaaaacacgacctaaaaaa
attagtttgagccgcgaacaactagaagcagaatggctttttttaacgagcgccaatgct
gtagagtattttttcatgaatcaacctggagaagcacattacaaaatagctgtaataggt
gaaaaaacaagagagaaattagcagaatttggctataaaccaagctttgttccgtctatc
tatcagtcagaaatttttttagaagagtggttaaatgaaaaccctgaaaaaacgagtgtc
ttactaccacaaagtaatttgagcagatccattataaaagacacgctgaccgaaaaagga
tatcttgttcattcagtggaactttatgaaacagtttccccagagaattctaaaataaag
ttaactgaactattgaattcaaatgacatacacatcattatttttgccagtccatcagct
tggaaaaacttctattccatcgcgaagtcattgcctgttcaaaaagaaaagtggcatatc
gcatcaattgggagtatcacgacagaagcaattttggcagatggctgggaagtgaaatat
caaccaaaaaccttcaccatgaagcacttagctgatttgattatacaggaggaattaaaa
tga

DBGET integrated database retrieval system