KEGG   Listeria monocytogenes M7: LMM7_1726Help
Entry
LMM7_1726         CDS       T01988                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA dehydrogenase/iron-dependent alcohol dehydrogenase/pyruvate-formate lyase deactivase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lmq  Listeria monocytogenes M7
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LMM7_1726 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMM7_1726 (adhE)
   00620 Pyruvate metabolism
    LMM7_1726 (adhE)
   00650 Butanoate metabolism
    LMM7_1726 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LMM7_1726 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LMM7_1726 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LMM7_1726 (adhE)
   00626 Naphthalene degradation
    LMM7_1726 (adhE)
Enzymes [BR:lmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LMM7_1726 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LMM7_1726 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1694424..1697024
Genome map
AA seq 866 aa AA seqDB search
MAIKENAAQEVLEVQKVIDRLADNGQKALKAFESYNQEQVDNIVHAMALAGLDQHMPLAK
LAVEETGRGLYEDKCIKNIFATEYIWNNIKNNKTVGVINEDVQTGVIEIAEPVGVVAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQRCSSEAAKVVYDAAVAAGAPEHCIQWVE
KPSLEATKQLMNHDKVALVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRSV
NDIILSKSFDQGMICASEQAVIVDKEVAKEVKAEMEANKCYFVKGAEFKKLESYVINPEK
GTLNPDVVGKSPAWIANQAGFKVPEDTKILVAEIKGVGDKYPLSHEKLSPVLAFIEAANQ
AEAFDRCEEMLVYGGLGHSAVIHSTDKEVQKAFGIRMKACRIIVNAPSAQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIADRRNNMQWFKLPPKIFFEKYSTQYLQKM
EGVERVFIVTDPGMVQFKYVDVVIEHLKKRGNDVAYQVFADVEPDPSDVTVYKGAELMKD
FKPDTIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGGKAKFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVTTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSIRAIELVFENLRESVLTGDPDAREKMHNASALAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNALKPRKHALFPRYESFRADEDYAR
ISRIIGFPAATTEEGVKSLVDEIIKLGKDVGIDMSLKGQNVAKKDLDAVVDTLADRAFMD
QCTTANPKQPLVSELKEIYLEAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaaatgcggcccaagaagtattagaagttcaaaaagtgattgacaga
ttagcagacaatggacaaaaagcattgaaagcatttgaaagttacaatcaagaacaagta
gacaatatcgttcacgcaatggcacttgccggacttgaccaacatatgccccttgcaaaa
ttagcagtagaagaaactggacgtggattatacgaagataaatgtattaaaaacatcttc
gcgacagaatatatttggaacaacattaaaaacaacaaaacagtaggcgttattaatgaa
gatgtacaaactggtgtgattgaaattgctgaaccagttggtgttgttgccggcgttaca
cctgtaactaacccaacatctactactcttttcaaagcaattatcgcaatcaaaacacgt
aacccaatcatcttcgctttccatccaagtgcacaacgttgttcatctgaagcagcaaaa
gttgtttatgatgcagcagttgcagctggagcaccagaacattgtattcaatgggtagaa
aaaccttccctagaagcaacaaaacaattaatgaaccacgataaagtagcacttgtactt
gcaactggtggtgctggaatggttaaatcagcatactctactggtaaacctgcactaggt
gttggaccaggtaacgtaccagcttacattgacaaaacagctaaaatcaaacgttctgtt
aatgacatcattctttctaaatcttttgaccaaggtatgatttgtgcttctgaacaagca
gtcatcgtggacaaagaagtcgctaaagaagttaaagcagaaatggaagcaaacaaatgc
tacttcgttaaaggcgctgaattcaaaaaattagaaagctatgtaatcaaccctgaaaaa
ggaacacttaacccagatgttgttggtaaatcccctgcatggattgcaaaccaagctggc
ttcaaagttccagaagatacaaaaattcttgtagctgaaattaaaggtgttggcgacaaa
tacccactatctcacgaaaaattaagcccagttcttgcattcatcgaagctgctaaccaa
gcagaagcattcgatcgttgtgaagaaatgttagtatacggaggacttggacactccgca
gttattcactctacggataaagaagttcaaaaagcatttggtattcgtatgaaagcttgc
cgtatcatcgtaaatgcaccaagcgcacaaggcggtatcggtgacatttataacggcttc
atcccttccctaacactaggttgtggatcttacggtaaaaactctgtatcacaaaatgta
agtgcgactaacttgctgaacgttaaacgtatcgcggatcggagaaataatatgcaatgg
ttcaaacttccaccaaaaattttctttgaaaaatattccactcaataccttcaaaaaatg
gaaggcgttgaacgcgtatttatcgtaactgacccaggaatggttcaattcaaatacgtt
gatgtagtaatcgaacatttgaaaaaacgtggcaacgatgtagcttaccaagtatttgct
gacgttgaaccagatccatctgacgttacagtttacaaaggtgcagaactaatgaaagac
ttcaaaccggacacaattatcgctcttggtggtggttccgcaatggatgctgccaaaggt
atgtggttattctatgaacacccagaagcttcattcttcggcttgaaacaaaaattctta
gatatccgtaaacgtactttcaaatatcctaaacttggtggaaaagcgaaattcgttgca
attccaacaacaagtggtacaggttctgaagtaactccatttgcggttattacagacaaa
gaaaacaacattaaataccctcttgctgactatgaactaactccagacgttgcgattgtt
gatgcacaatatgtaactactgttccagcacacattactgctgatactggtatggacgtt
ctaactcacgcaattgaatcttatgtatccgtaatggcaagcgattatactcgtggatta
tctatccgcgcaatcgaacttgtatttgaaaacttacgtgaatctgttcttactggtgat
cctgatgcgcgtgaaaaaatgcataatgcttctgccctagctggtatggcgtttgcgaat
gcgttcctaggaattaaccacagcttggcacacaaaattggacctgaattccacattcct
cacggtcgtgcgaatgcaatccttatgccacatgttatccgttataacgcgcttaaacct
agaaaacatgcgttattcccaagatatgaaagcttccgtgctgatgaagattatgctcgt
atctctcgtattatcggcttccctgctgcaactacagaagaaggcgttaaatcacttgta
gatgaaatcatcaaacttggtaaagatgttggtatcgacatgagtcttaaaggacaaaat
gttgctaaaaaagacttggatgcggttgtagacacacttgcagatcgcgcattcatggac
caatgtactactgccaaccctaaacaaccacttgtaagtgaactaaaagaaatttaccta
gaagcttacaaaggtgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system