KEGG   Listeria monocytogenes M7: LMM7_1753Help
Entry
LMM7_1753         CDS       T01988                                 

Gene name
ansB
Definition
(GenBank) asparagine synthase (glutamine-hydrolysing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmq  Listeria monocytogenes M7
Pathway
lmq00250  Alanine, aspartate and glutamate metabolism
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMM7_1753 (ansB)
Enzymes [BR:lmq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LMM7_1753 (ansB)
Peptidases [BR:lmq01002]
 Cysteine Peptidases
  Family C44
   LMM7_1753 (ansB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AEH92758
UniProt: A0A0E0UXE0
Position
complement(1727941..1729806)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPGVFKSMLNSVARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLDLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaatagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgcgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgt
cttcgtgggatgtttggtttcgttatttgggataaacaagaagaacttgtttacggcgca
cgcgacccatttggcattaaaccatttttctatgcagaagaagacggcaaattgttcatg
ggttctgaaaagaaatccattttacatgctttaaaagaaaaagaattagatgaagtttca
ttacaaaactatatgacttatcaattcgttccagaaccagattccttaactaaaaatgta
aaacgtttagaaccaggacatcagttcacgaagaaaattggtcaaccaatggaaattact
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtaatgtacgattctgtaaaaatgcatatgcgctctgatgtaccagttggt
tcattcctatccggtggtattgattcatcgattattgctgcgattgctaaagaatatcat
ccagcaattaaaacattctctgttggttttgaacgcgatggtttcagtgaaatcgatgtc
gcaaaagaaacagcagacaaacttggcgtagaaaacattagttatgttatttcaccggaa
gaatatatgaaagaattaccaaaaattgtttggcatatggatgatccacttgctgatccg
gctgctattccgctttacttcttatcaagagaagcgcgcaaacaagtaacggttgcattg
tccggtgagggggcagatgaacttttcggtggttataacatttataacgaaccaaattcc
cttgcgatgtttaacaaaatgccaggcgtatttaaatcaatgttaaatagcgtggcgcgt
attatgccagaaggtatgcgtggtaaaagtttcttagaacgtggaactactccgatggaa
gaacgctatatcggaaacgcgaaaatgttcacggaaaaagaaaaacaaattttacttccc
aaataccaagctggacatgattatacgaacattacagatccattttatgcggaaacaacg
aattatcatcctgtagaaagaatgcagtatattgatattcatacgtggcttcgtggcgat
attctcttaaaagctgaccgcatgacaatggctaattcactggaagtccgtgtacctttc
cttgataaagaagtgtacaatgtggcaagaaatattccagatacaatgaaaacaaccaac
ggaactactaaatatatcttacgtaaagcggcagcaacatttgtaccagaacatgtactt
aatcgtcgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaatatcattaaagaatcaccaaccgatcatttaattaacaaacaatac
gtgctagacttactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagttgttattttcatgatttggtacgatgtatacgtagcagacaaatacgactttgga
aaataa

DBGET integrated database retrieval system