KEGG   Listeria monocytogenes M7: LMM7_1967Help
Entry
LMM7_1967         CDS       T01988                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lmq  Listeria monocytogenes M7
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmq00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lmq00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1958407..1958889)
Genome map
AA seq 160 aa AA seqDB search
MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTI
VLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEF
EADTAFPKVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatttttgtttgggcacaagaccgcgctggtaatattggaaaagataacaaaatg
ccgtggcacttaccaggagatttgcagtttttcaaaaaaacgacgactgggaaaacactt
gtcatggggcgaaaaacctatgaatcgttaggaaaagctttaccaaatagaaagacaatc
gtattgacacgagatcaaggtctcaagttagatgatgcagagatacttcattcaaaagaa
gctgttctagcccttgctgagacaggggaaccaatctatatagttggtggtgcagaaatc
tatcgtttatttatggatgtggcggatcagctgattgtgacaaaaattgatgcagagttt
gaggctgatactgcgtttcctaaagtggattgggagaatttttccgaagtggcgaaagaa
ttccatgaaaaagatgaaaaaaataagtacaattacactttttatacgtatgaaagaaat
tag

DBGET integrated database retrieval system