KEGG   Listeria monocytogenes M7: LMM7_2492Help
Entry
LMM7_2492         CDS       T01988                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lmq  Listeria monocytogenes M7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2506632..2507378)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENDYTCYAPQYRGHGVSPDLL
LKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTPEQIDAEMVAYKDAPMNTIAKLKDEINGVVAEIDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELRWFKESGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccattcctattcgaaaaaggcaaaagagcagtgttactc
ttacacggtttcacaggtagctcagcggatgtaagaatattaggtaggtttttacaagaa
aacgattatacttgctatgcgcctcaatacagaggccacggtgtatctcctgacctactg
ttaaaaacgggaccaaacgattggtgggaagatgttcttgaagcctatgatcacctaaaa
tcactcggttacacggaaatcgctgtagcgggactttcgctaggtggacttttttcacta
aaattaggtttttctaggccgttaaagggaattatagccatgagtactccaacaagaatg
gacagttcatcaccaataattcaaggctttttagattatgtgcgtaattataaaaaatta
gaaggtaaaacacctgaacaaatcgatgctgaaatggttgcctataaagacgccccaatg
aacaccatcgctaaactaaaggacgagataaatggcgtcgtggctgaaatagatatgatt
tatgcgccaataatggtcgtccaaggtgaaaaagacgatatggttgatgtgagcggagcg
cagctaatttatgatacagtagagtcaacgaagaaagaattacgctggtttaaagaatct
ggtcatgtcatcactttagacaaagaacgaaaagaagtaaatcaagccattttaacattt
ttagatagtttagattggcaagaatag

DBGET integrated database retrieval system