KEGG   Listeria monocytogenes M7: LMM7_2846Help
Entry
LMM7_2846         CDS       T01988                                 

Definition
(GenBank) putative sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
lmq  Listeria monocytogenes M7
Brite
Enzymes [BR:lmq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     LMM7_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Prp18
Motif
Other DBs
NCBI-ProteinID: AEH93851
UniProt: A0A0E0UZV6
Position
2832595..2834277
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLEKMLACAENYSNNARGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDVITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDYKNVTRPRTSPLFH
QYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIISLWRLLIDELYPNLQIITETNVPHEENISYFGDGENEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSSTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNPGEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELETDTYRQTIFTSLKKLVQIR
RNHAAFSPFATQEILDLGPDVFAIKRESEEECIYGIINVTSHNIRKTLAFSGTNLLTNQP
VASELDLTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagctgca
taccaacccgcatacttggaaaaaatgctcgcatgcgctgaaaactattctaataatgcg
cgtggttcgattgatactatttccgaaaaaaacgtctatcttattgcttatggcgacagc
attttcgaaaaaaacaagcatccgttacaaacattaaatgagttcctacaagaatatgca
caagatgttattacagatgtccacttgctgccgattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggttcaagcgattctccgataacgaagcgccgtacaatcaatttttcatcgag
aaggacagccaatttgattataaaaacgtcacacgtccgcggacttctccgctattccac
caatacgaaaacggcaaagaactttggactacttttagcgaagatcagttagacttaaac
gtccgtaatatcgattgccttgtagccttaacagatgtcctgcttttctatgcatccaaa
caagctacaagcattcgtcttgatgccattggatttttatggaaaacatctggcacgact
tgtatgcacctaccagaaacgcatgaaatcatttcgctttggcgtctgctgattgatgaa
ctatatccgaatctgcaaattatcacagaaaccaacgtccctcatgaagaaaacattagt
tattttggcgatggcgaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctagcacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggccaagtttcctataaagacaacgcagatggcacgcagtcggtatac
gaacttaatattaactacggtgaagctctgcaaaacccgggcgaagacacaaccgaagaa
ctcgtaacgaaaaaaattatcgctgcccatagtattttgctaacacttcaaggcgtccca
gcgatttactatcattcccttctaggttctaaaaacgaccttgttggttacgaagaatcc
ggtattaatcgccgcatcaaccgtgaaaaactggaaaaaaatcaattggttcatgaactt
gaaacagacacttatcgccaaaccattttcacatcgttgaaaaaattggtgcaaatcaga
cgaaaccacgccgctttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgataaaacgggaatctgaggaagaatgtatttacggaattatcaatgtcact
tctcacaatatccgcaaaacgctcgctttctctggcacgaatttattaactaatcaaccc
gttgcgagtgaacttgatttaactgcgtatgaagttgtctggattaagaaggctgtccaa
tga

DBGET integrated database retrieval system