KEGG   Listeria monocytogenes Finland 1998: LMLG_0290Help
Entry
LMLG_0290         CDS       T01986                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lms00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2748271..2749953
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLKKMLACAENYSNNTRGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDAITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDFKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIISLWRLLIDELYPNLQIITETNVPHEENISYFGDGENEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSSTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNPGEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELETDTYRQTIFTSLKKLVQIR
RNHTAFSPFATQEILDLGPDVFAIKRESEKECIYGIINVTSHNIRKTLAFSGTNLLTNQP
VASELDLTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagccgct
tatcagcccgcatacttgaaaaaaatgctcgcatgcgccgaaaactattctaacaatacg
cgtggttctattgatactatttccgaaaaaaatgtctatcttattgcctatggcgacagc
attttcgaaaaaaacaaacatccgttacaaacattgaatgaattcctacaagaatatgca
caagatgctattacagacgtccacttactaccaattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggttcaagcgattctccgataatgaagcgccgtacaatcaatttttcattgag
aaagacagccaatttgattttaaaaatgttactcgcccgcggacttctccgctgttccac
aaatacgaaaacggcaaggaactttggactacttttagcgaagaccagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtcctgcttttctatgcatccaag
caagctacaagcattcgtcttgatgccattggatttttatggaaaacatctggcacgact
tgtatgcacctaccagaaacgcatgaaatcatttcgctttggcgtctgctgattgatgaa
ctatatccgaatctgcaaattatcacagaaaccaacgtccctcatgaagaaaacattagt
tattttggcgatggcgaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctagtacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggccaagtctcctataaagacaacgcagatggcacgcagtcggtatac
gaacttaatattaactacggtgaagccctgcaaaacccgggcgaagacacaaccgaagaa
ctcgtaacgaaaaaaattatcgctgcccatagtattttgctaacacttcaaggcgtccca
gcgatttactatcattcccttctaggttctaaaaacgaccttgttggttacgaagaatcc
ggtattaatcgccgcatcaaccgtgaaaaactggaaaaaaatcaattggttcatgaactt
gaaacagacacttatcgccaaaccattttcacatcgctgaaaaaattggtgcaaatcaga
cgaaaccacaccgctttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgattaaacgggaatctgagaaagaatgtatttatggaattatcaacgtcact
tctcataatatccgcaaaacgctcgctttctccggcacgaatttattaaccaatcaaccc
gttgcgagtgaacttgatttaaccgcgtatgaagttgtctggattaagaaggctgtccaa
tga

DBGET integrated database retrieval system