KEGG   Listeria monocytogenes Finland 1998: LMLG_0290Help
Entry
LMLG_0290         CDS       T01986                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
lms  Listeria monocytogenes Finland 1998
Brite
Enzymes [BR:lms01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     LMLG_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Prp18
Motif
Other DBs
NCBI-ProteinID: AEO40200
Position
2748271..2749953
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLKKMLACAENYSNNTRGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDAITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDFKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIISLWRLLIDELYPNLQIITETNVPHEENISYFGDGENEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSSTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNPGEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELETDTYRQTIFTSLKKLVQIR
RNHTAFSPFATQEILDLGPDVFAIKRESEKECIYGIINVTSHNIRKTLAFSGTNLLTNQP
VASELDLTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagccgct
tatcagcccgcatacttgaaaaaaatgctcgcatgcgccgaaaactattctaacaatacg
cgtggttctattgatactatttccgaaaaaaatgtctatcttattgcctatggcgacagc
attttcgaaaaaaacaaacatccgttacaaacattgaatgaattcctacaagaatatgca
caagatgctattacagacgtccacttactaccaattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggttcaagcgattctccgataatgaagcgccgtacaatcaatttttcattgag
aaagacagccaatttgattttaaaaatgttactcgcccgcggacttctccgctgttccac
aaatacgaaaacggcaaggaactttggactacttttagcgaagaccagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtcctgcttttctatgcatccaag
caagctacaagcattcgtcttgatgccattggatttttatggaaaacatctggcacgact
tgtatgcacctaccagaaacgcatgaaatcatttcgctttggcgtctgctgattgatgaa
ctatatccgaatctgcaaattatcacagaaaccaacgtccctcatgaagaaaacattagt
tattttggcgatggcgaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctagtacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggccaagtctcctataaagacaacgcagatggcacgcagtcggtatac
gaacttaatattaactacggtgaagccctgcaaaacccgggcgaagacacaaccgaagaa
ctcgtaacgaaaaaaattatcgctgcccatagtattttgctaacacttcaaggcgtccca
gcgatttactatcattcccttctaggttctaaaaacgaccttgttggttacgaagaatcc
ggtattaatcgccgcatcaaccgtgaaaaactggaaaaaaatcaattggttcatgaactt
gaaacagacacttatcgccaaaccattttcacatcgctgaaaaaattggtgcaaatcaga
cgaaaccacaccgctttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgattaaacgggaatctgagaaagaatgtatttatggaattatcaacgtcact
tctcataatatccgcaaaacgctcgctttctccggcacgaatttattaaccaatcaaccc
gttgcgagtgaacttgatttaaccgcgtatgaagttgtctggattaagaaggctgtccaa
tga

DBGET integrated database retrieval system