KEGG   Listeria monocytogenes Finland 1998: LMLG_0538Help
Entry
LMLG_0538         CDS       T01986                                 

Definition
glycosyl hydrolase, family 1 protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_0538
Enzymes [BR:lms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMLG_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
606420..607814
Genome map
AA seq 464 aa AA seqDB search
MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRFFNDVGPTNTSNFYYQ
YKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRVIDEMLANDVEPFMNLY
HFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFTFNEPIVPVEAGYLYDMH
YPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIILNLTPSYPRSQNPADLKAA
HIADLIFNRSFLDPVTKGEFPTDLVEIIREHDALPEYTEEDLAIIKNNIIDILGVNYYQP
RRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEIFERAIYDIAINLRDNYDNIP
FFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWLHKAIEEGANCHGYHLWTFMDC
WSWANAYKNRYGLVEVDLDNDFKRTVKASGHWYKELAENNGFED
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaatttccagagaatttttggtggggaagtgcagcatccggcccacaaaca
gaaggcgcagcaaatgtagatggcagaaaaccaagtatttgggatcactggtacaaaatc
gaaccaggtcgtttctttaacgatgtagggcctacgaatacatctaatttttactatcaa
tataaagaagatattgctttaatgaaacaaactgggcataattctttccgtacatcgatt
cagtggtcacgtcttattccagatggtattggtgaagtgaacccgaaagcagttgatttt
tacaatcgggttattgatgaaatgcttgcaaatgacgtggaaccatttatgaatttatat
cattttgatatgccaatgtcgatgcaagaaaaaggcggttttgaaagccgtgaagtagtg
gacgcatatgctacatttgcgaaaacttgttttgaattatttggtgatcgtgtgaaacat
tggtttacttttaatgaaccaattgttccggttgaagcgggctatttatacgatatgcac
tatccgaatgtcgttgattttaaacgtgcgacacaggtagcttatcatactactttggca
catgcccttgctgtaaaagaattccatgcccttgaaattccagaaggccaaatcggtatt
attttaaacttaacgccgtcgtatccaagaagccaaaatccagctgatttaaaagcggct
catattgcggatctaattttcaaccgaagtttccttgatccggttacaaaaggggaattc
ccgactgatcttgtagaaattatccgcgaacatgacgcgcttccagaatatacggaagag
gatttagcgataattaaaaacaacattattgatattcttggtgtgaactactaccaaccg
cgtcgtgtgaaagcgaaagaatacgcggctcacccggatgcgccgtttatgccagaacac
ctttttgataattatgaaatgccttaccgtaaaatgaatccgtatcgtggctgggaaatt
tttgaaagagcgatttatgatattgcgattaatctgcgcgacaactacgataatatcccg
ttctttatttccgaaaatggtatgggtgtggaaggcgaaagtcgttatcgtaacgcagac
ggaatgattgaagatacgtaccgaattgacttcattaagagtcatttgaaatggcttcat
aaagcaattgaagaaggcgctaactgccatggttaccacctttggacgttcatggattgc
tggagctgggcgaatgcttacaaaaaccgttatggcttagtggaagttgatttggacaat
gacttcaaacgtaccgtgaaagcatctgggcattggtacaaagaacttgcagaaaacaat
ggttttgaagactaa

DBGET integrated database retrieval system