KEGG   Listeria monocytogenes Finland 1998: LMLG_0703Help
Entry
LMLG_0703         CDS       T01986                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMLG_0703
   01230 Biosynthesis of amino acids
    LMLG_0703
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_0703
   00051 Fructose and mannose metabolism
    LMLG_0703
   00562 Inositol phosphate metabolism
    LMLG_0703
Enzymes [BR:lms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMLG_0703
Exosome [BR:lms04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMLG_0703
  Exosomal proteins of bladder cancer cells
   LMLG_0703
  Exosomal proteins of melanoma cells
   LMLG_0703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(384282..385046)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIQLALDE
KITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNVVLAYEPEWAIGKANSAD
TDYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatatcaatactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttggaaatttttctgatgtggatacgttt
atctttccttctatgggaacactcgaaacgactgccaaccttttagcggggacatcattt
ggttttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatcaatcattgatctaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcaaagaaaatccaactcgcgctggatgaa
aaaatcactcctgtagtatgtgtgggtgaaggcattcgcgcaaatgatacgaacgaatta
aaaaatgcgcttaaaaagcaaatcgaagcgctatttgacactattcaagtaacacaattt
aaaaatgtcgttctggcttatgaaccggaatgggcaattggcaaggcaaattccgctgac
acagactacatcgaaagcgctcatcaagctttgcgtgaaattattcgcgaactaggcggt
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system