KEGG   Listeria monocytogenes Finland 1998: LMLG_1148Help
Entry
LMLG_1148         CDS       T01986                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00260  Glycine, serine and threonine metabolism
lms00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01130  Biosynthesis of antibiotics
lms01230  Biosynthesis of amino acids
Module
lms_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMLG_1148
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMLG_1148
Enzymes [BR:lms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMLG_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEO39155
Position
complement(1648694..1649467)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTNKLAEKEHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKEQVSLEAILNKLAMSKVQIPLIIMSYINPIFHLGIPKFVELVQKTPVKG
LIIPDLPYEHQKLITPELQGTDIALIPLVSLTSPKERLEEIAKQAEGFIYAVTVNGTTGV
RSEFDAHIDSHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEEKT
AELGAFLQKAAEVRIKN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacgaataaactagcggaaaaagagcatgctgctgtcgttacttat
attatgggtggagatggtggtttagataatttagaagaacagttattgtttctagaaaaa
tctggcgtaagcgcgattgaaattggcattcctttttctgatccggttgctgacggacca
attattcaacttgctgggttacgtgctttaaaggagcaagtgagtttagaagccatttta
aataaattggctatgagtaaagtgcaaattccgctaattattatgagttatattaatccg
atttttcatttaggtattccaaaatttgttgaattggtgcagaaaacgccggtgaaaggg
cttattattccggatttaccttatgagcaccaaaaactgattacaccagaacttcagggg
acagatatcgcactcattccactcgtttcattgactagcccgaaagagcgccttgaagaa
attgcgaaacaggcagaaggatttatatatgcagtaacagttaacggaactactggtgtg
aggagtgaatttgatgcccatattgatagccatttagcttatttgaaaagcattagccct
gttccagttctcgcaggttttggtgtttcttctattgaacatgtagaaaaatttgcgcac
gtatgtgatggtgtgataatcggtagtaaagtcgtgcaaatgttgcatgaagaaaaaacg
gcagagctaggagcgtttttacaaaaggctgctgaagttcgaatcaaaaactaa

DBGET integrated database retrieval system