KEGG   Listeria monocytogenes Finland 1998: LMLG_1149Help
Entry
LMLG_1149         CDS       T01986                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMLG_1149
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMLG_1149
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMLG_1149
Enzymes [BR:lms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMLG_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649460..1650662)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYQASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMKCTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDASVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASKMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggtagatttgta
ccagaaacattaatgaaagcagtgaaagaattagatgaggcgtaccaagcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgccgaacaactaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaacaatactattggtcaagcctta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggcgcgggtcaacacggc
gtggcaacagcaactgttgcagcactttttaatatgaaatgtactatttttatgggagaa
gaagatgtaaaacgtcaatcactcaatgtatttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagatgcagtaaatgaagcgcttaggttc
tgggttgcaaatgtggaagatacgcattacattatgggatctgttcttggaccacaccca
tttccagaaatcgttcgtgattaccaaagcgtaataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgtagcttgtgttggaggcgggagtaat
gcgatgggcttattttatccatttgtagacgatgcttctgttcaaatgcacggtgtggaa
gcagctggtcacggtttagagacagaattccacgcagcaaccatttccaaaggagaaatt
gggattttacacggagcgatgatggatgtattacaagatgagaatgggcaaattttggaa
gcattttcgatttctgctggcttagattatccgggtattggtccagagcatagctttttc
cgtgatttaggtcgcgcagcgtatcattctgttactgatgatgaagcagtcgaagccttt
caacttttatgtcgtacggaaggaattattccagcgctcgaaagttctcacgcaattagc
tatgcggttaaacttgcaagtaaaatgcgtccagaagaaagtatggttgtttgtttatct
ggtcgcggagacaaagacgttaaccaactaaaagaacgtttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system