KEGG   Listeria monocytogenes Finland 1998: LMLG_1149Help
Entry
LMLG_1149         CDS       T01986                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00260  Glycine, serine and threonine metabolism
lms00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01130  Biosynthesis of antibiotics
lms01230  Biosynthesis of amino acids
Module
lms_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMLG_1149
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMLG_1149
Enzymes [BR:lms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMLG_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1598
Motif
Other DBs
NCBI-ProteinID: AEO39156
Position
complement(1649460..1650662)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYQASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMKCTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDASVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASKMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggtagatttgta
ccagaaacattaatgaaagcagtgaaagaattagatgaggcgtaccaagcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgccgaacaactaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaacaatactattggtcaagcctta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggcgcgggtcaacacggc
gtggcaacagcaactgttgcagcactttttaatatgaaatgtactatttttatgggagaa
gaagatgtaaaacgtcaatcactcaatgtatttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagatgcagtaaatgaagcgcttaggttc
tgggttgcaaatgtggaagatacgcattacattatgggatctgttcttggaccacaccca
tttccagaaatcgttcgtgattaccaaagcgtaataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgtagcttgtgttggaggcgggagtaat
gcgatgggcttattttatccatttgtagacgatgcttctgttcaaatgcacggtgtggaa
gcagctggtcacggtttagagacagaattccacgcagcaaccatttccaaaggagaaatt
gggattttacacggagcgatgatggatgtattacaagatgagaatgggcaaattttggaa
gcattttcgatttctgctggcttagattatccgggtattggtccagagcatagctttttc
cgtgatttaggtcgcgcagcgtatcattctgttactgatgatgaagcagtcgaagccttt
caacttttatgtcgtacggaaggaattattccagcgctcgaaagttctcacgcaattagc
tatgcggttaaacttgcaagtaaaatgcgtccagaagaaagtatggttgtttgtttatct
ggtcgcggagacaaagacgttaaccaactaaaagaacgtttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system