KEGG   Listeria monocytogenes Finland 1998: LMLG_1151Help
Entry
LMLG_1151         CDS       T01986                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01130  Biosynthesis of antibiotics
lms01230  Biosynthesis of amino acids
Module
lms_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMLG_1151
Enzymes [BR:lms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LMLG_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AEO39158
Position
complement(1651270..1652028)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKEVEVAKMPLEQVAEKRKTYSFYEFLKANTNTMQLIAEVKRASPSKGEIN
MGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVGIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEKLITLFEQALALDLEVLVEVHDQEELAVAQKIGAQLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYDAVLVGEALMREAT
PEVAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagaagtagaagttgcaaaaatgccctta
gaacaagtagcagaaaaacggaaaacttattcgttttatgaatttttaaaagcaaataca
aacacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccagttctgcaagccaagtcttatcaagccgcgggtgcgggaatgatt
tctgttttgacagatcctgtttttttcaaaggttcgattgaagatttgcgagaagtagcg
aaaaatgtgggaattcctgtactctgtaaagatttcattattagtgaaaaacaattgatt
cgcgctcgaaatgcgggagcgacggttgtgttgttaattatttcggcacttacagaagag
aagctaatcaccctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccaggaagaattagctgttgctcaaaaaatcggagctcaactcattggtgtaaac
aatcggaatttgcacacatttgaagtggatattgcagtaagcgaaagactggcgagtgat
ttttcgtcggatgcttgttttataagcgaatcaggttttcgaacagcagaagatgtggct
cgcgtgagtcaaaaatatgatgcggtacttgttggagaagcgttaatgcgagaagcgact
ccagaagtggcagcgaagagtttgaaggtgacacgatga

DBGET integrated database retrieval system