KEGG   Listeria monocytogenes Finland 1998: LMLG_1758Help
Entry
LMLG_1758         CDS       T01986                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMLG_1758
   01230 Biosynthesis of amino acids
    LMLG_1758
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_1758
   00030 Pentose phosphate pathway
    LMLG_1758
   00051 Fructose and mannose metabolism
    LMLG_1758
   00052 Galactose metabolism
    LMLG_1758
  Energy metabolism
   00680 Methane metabolism
    LMLG_1758
Enzymes [BR:lms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMLG_1758
Protein phosphatases and associated proteins [BR:lms01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMLG_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1590329..1591288)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagttgttatc
ggtggagatggttcttatcacggagcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaacaattgataatgatatttctggaactgattttactattggttttgat
actgcattaaatactgttcttgatgcacttgataaaatccgcgatacagctacaagtcac
gaacgtactttcattattgaagttatgggtcgcgacgctggtgatatcgctctttggtct
ggtcttgctggtggcgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggcaaaaaacatagtattatcgtcgta
gctgaaggcgtaatgtctggtaatgaatttgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccgactgcatttgac
cgtgtacttgcaagtcgtcttggtgcacgttcagtagaattattgctagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgagattttg
aaagaaaaacacactcttgatcaaaaattatttgatcttgcatcaattttgtcgatttaa

DBGET integrated database retrieval system