KEGG   Listeria monocytogenes Finland 1998: LMLG_1797Help
Entry
LMLG_1797         CDS       T01986                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lms00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMLG_1797
Enzymes [BR:lms01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LMLG_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1548545..1549150)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEADLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgttgag
gcaggacaaatcggctatcaaataattacagggaacccgttttcctttcaacgactagaa
ggtacagaagcgcaagtctttttgtatcagcatgtgagagaggataatatttctttattt
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcactagccattattgcttcaggcgatgtcgttccactaatttcagcg
attgaatccgaagacgatgtttatttaaccaaatttccgagtgtcggtaaaaaaacagct
cgccaaattattcttgatttaaaaggaaaactggctgatgttgttgcgagcgaaattgtt
tatgttgccccagaaaacgatatggttgcgggactttccccgcaattagaagaggccgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gctaaagaagctgacttaacaagcgacgcatatatcaagctagcgctacaattaatgaca
aaatag

DBGET integrated database retrieval system