KEGG   Listeria monocytogenes Finland 1998: LMLG_1824Help
Entry
LMLG_1824         CDS       T01986                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_1824
   00052 Galactose metabolism
    LMLG_1824
Enzymes [BR:lms01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LMLG_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2489403..2490446)
Genome map
AA seq 347 aa AA seqDB search
MKERFGEFEGETVWKWTMINDHDMRMSVLNYGAIVTSLETKDKFGDFANISLGFTNLDDY
LAHSPYFGATLGPVAGRITNGQFSLDGKQFQLIQNEGSNHRHGGKFNFSKKLWDVSVEKS
LDQIVMTFEYCWADGENGYPGKIDAKMTYTLNNKNEWLVDYEARSNQPTIYNPSNHIYFN
LSGEAGSTVLQHQLWVNSDSFLPIDEEFLPIGEKRLAENTIFDLRAGREVAEITQSQDQQ
VKLVGAGLDHTFILKHENGRPDAVLFDPKSGRRLEMETKADSVLIYTANSLDGSFEIDER
AVPKYAGITMETQGLVDAINHDGFGDIVLRPEKPFTSRTAFRFTVES
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcgatttggggagtttgaaggagaaactgtttggaagtggacgatgataaat
gatcatgatatgcgcatgagtgttttaaattacggagcgattgttacttcacttgaaaca
aaagataaatttggtgattttgcgaatattagtcttggttttacaaatttagatgattat
ttggcacactctccttacttcggcgcgacacttggccctgttgctggacgtattacaaat
gggcaatttagtttggatggcaaacaatttcaactgattcaaaatgaaggctctaaccat
cgtcacggtgggaaattcaattttagtaagaagctttgggatgtttcagtagaaaaaagt
cttgatcaaattgtgatgacttttgaatactgctgggcggatggagaaaatggctatcca
ggaaaaattgatgcaaaaatgacatatacgttaaataataaaaatgaatggctggttgat
tatgaagcgagaagcaatcagccgactatatataacccgagcaatcatatttattttaat
ctgagcggagaagctggttcaacggttttacaacatcagctttgggtcaatagtgatagc
ttcctaccaattgatgaagagttcctcccaattggggaaaagcggttagcggaaaatact
atctttgatttgcgtgcaggtcgtgaagtagcggagattacacaaagtcaggaccagcaa
gtaaaattagttggtgcggggctggatcatacgttcattttaaaacatgaaaatggtcgt
ccagatgcagttttgtttgatccaaagtcaggacggcgcttggaaatggaaaccaaagct
gactcggtattaatttatacggcgaatagtttggatggctcttttgagattgacgagcga
gctgtgccaaaatatgctggcataacaatggaaacacagggtttggtggatgcgattaac
catgacggatttggtgatattgtacttcgaccagaaaaaccttttacatctagaacagct
tttcgtttcacagtggagagctga

DBGET integrated database retrieval system