KEGG   Listeria monocytogenes Finland 1998: LMLG_1922Help
Entry
LMLG_1922         CDS       T01986                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00010  Glycolysis / Gluconeogenesis
lms00052  Galactose metabolism
lms00500  Starch and sucrose metabolism
lms00520  Amino sugar and nucleotide sugar metabolism
lms00521  Streptomycin biosynthesis
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01120  Microbial metabolism in diverse environments
lms01130  Biosynthesis of antibiotics
lms01200  Carbon metabolism
Module
lms_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lms_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_1922
   00052 Galactose metabolism
    LMLG_1922
   00500 Starch and sucrose metabolism
    LMLG_1922
   00520 Amino sugar and nucleotide sugar metabolism
    LMLG_1922
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMLG_1922
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LMLG_1922
Enzymes [BR:lms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMLG_1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEO38868
Position
1346582..1347550
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEFTGKSALKDAIDNNETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaggaaaaatggactattgatacaaatattgaagataaaggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacagacttacaacta
gataatgatattttttacggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacctagggtgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttgaaaatcatattagataatgatgcgaatgttgccgctctt
ggcgaacgctggaaaggcgcaggtgaaggtggcgcgaatgttgttttcgtaacacttgga
acaggcgttggcggtggtatttttgcggaaggtaaaattttacatggcatccgcggggca
gcaggcgaaataggccacgtaacagtagttcctgagaatggttacgattgtacttgtggt
aaaaaaggatgtctagaaactgtcgcatcagcaacaggaattgttcgagtagcgaaagat
ttagcaaaagagtttactggtaaatctgctcttaaagatgcaatagacaacaacgaaacg
attacctccaaattgatttttgaactaggtgcggaagatgatgcattagcgaatgaaaca
attgataaaatttctttctatttggctttagcgcttagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggagtttcagcagcaggagatcaattattgacaccg
gttaaaacttattttgaaacgatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgatgcagggataattggagctgcgtggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system