KEGG   Listeria monocytogenes Finland 1998: LMLG_2355Help
Entry
LMLG_2355         CDS       T01986                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lms00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065546..1067009
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKEGKLVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIA
DILTKHDLITADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKEICETLKEAGYE
KRIKQLTGLKIDSYFSASKMMWLLENISAVRDAASHNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGSFGSYQEIPIHSVMADSEA
ALYGQGCDTFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGAPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMIGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPVEELSAIGVVEIAENKPKNKRTIAKLYQPSITHTNALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatagccattgatcaaagcacatctggtacgaaagtattattg
tttaaagaaggcaaacttgtagatcgtttagataaaaagcatcgacagttgtatccaaag
aaaggctgggtggaacataatcccatcgaaatttgtcaaaatgtccgtacattaattgcg
gacatcttgacaaaacatgatttaattacagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacggggaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaaatttgcgaaacgttaaaagaagctggttatgaa
aaaagaattaaacagcttaccggactgaaaatcgattcttatttttctgcttctaaaatg
atgtggttattggaaaatatttcagcggtgcgggatgcagcaagtcataatcaattggca
tttggcacaatggacgcttggttgttattttcacttacggatgatagtaattatttcaca
gaccgaacaaatgctagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaacttttcggagtcaaacgtgcttatttaccagaagtgaaacaatctgct
ggaagttttggaagttatcaggagataccaattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatacatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaacgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaagggattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggcgccccttattggaatacagatatacgagcagagattcttggcctcacg
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgataggtcaaaatattaagcgcttacaagta
gacggtgggttaacaaagcaacatgaattgatgcaatatttagctgatgttttaaaagca
gaagtggcagtcagtcccgtggaagaactttcggcaattggtgttgttgaaattgccgaa
aataaaccaaaaaataagagaacgatagcgaaattgtaccaaccaagtatcactcataca
aatgctttggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

DBGET integrated database retrieval system