KEGG   Listeria monocytogenes Finland 1998: LMLG_2355Help
Entry
LMLG_2355         CDS       T01986                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LMLG_2355
Enzymes [BR:lms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LMLG_2355
Exosome [BR:lms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMLG_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065546..1067009
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKEGKLVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIA
DILTKHDLITADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKEICETLKEAGYE
KRIKQLTGLKIDSYFSASKMMWLLENISAVRDAASHNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGSFGSYQEIPIHSVMADSEA
ALYGQGCDTFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGAPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMIGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPVEELSAIGVVEIAENKPKNKRTIAKLYQPSITHTNALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatagccattgatcaaagcacatctggtacgaaagtattattg
tttaaagaaggcaaacttgtagatcgtttagataaaaagcatcgacagttgtatccaaag
aaaggctgggtggaacataatcccatcgaaatttgtcaaaatgtccgtacattaattgcg
gacatcttgacaaaacatgatttaattacagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacggggaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaaatttgcgaaacgttaaaagaagctggttatgaa
aaaagaattaaacagcttaccggactgaaaatcgattcttatttttctgcttctaaaatg
atgtggttattggaaaatatttcagcggtgcgggatgcagcaagtcataatcaattggca
tttggcacaatggacgcttggttgttattttcacttacggatgatagtaattatttcaca
gaccgaacaaatgctagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaacttttcggagtcaaacgtgcttatttaccagaagtgaaacaatctgct
ggaagttttggaagttatcaggagataccaattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatacatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaacgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaagggattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggcgccccttattggaatacagatatacgagcagagattcttggcctcacg
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgataggtcaaaatattaagcgcttacaagta
gacggtgggttaacaaagcaacatgaattgatgcaatatttagctgatgttttaaaagca
gaagtggcagtcagtcccgtggaagaactttcggcaattggtgttgttgaaattgccgaa
aataaaccaaaaaataagagaacgatagcgaaattgtaccaaccaagtatcactcataca
aatgctttggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

DBGET integrated database retrieval system