KEGG   Listeria monocytogenes Finland 1998: LMLG_2488Help
Entry
LMLG_2488         CDS       T01986                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00010  Glycolysis / Gluconeogenesis
lms00030  Pentose phosphate pathway
lms00051  Fructose and mannose metabolism
lms00680  Methane metabolism
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01120  Microbial metabolism in diverse environments
lms01130  Biosynthesis of antibiotics
lms01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_2488
   00030 Pentose phosphate pathway
    LMLG_2488
   00051 Fructose and mannose metabolism
    LMLG_2488
  Energy metabolism
   00680 Methane metabolism
    LMLG_2488
Enzymes [BR:lms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LMLG_2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: AEO38372
Position
complement(861249..863210)
Genome map
AA seq 653 aa AA seqDB search
MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNG
SGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELC
QYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISA
LSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVC
AANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEIT
QIARMHKAISIIQFKLEGEIINRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFP
TINPENPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPL
HEDGTFMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSL
FGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPV
KEGKGESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIK
NETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactattgatatgaaatatttacgcttgttagcaaaagaatatcctactatcgcc
aagacagctacggaaatcattaacctcgaagcaattatgaaccttccaaaaggaacggaa
cattttttaagtgatgttcacggtgaatatagtgcttttgaacaggtgcttcgtaatggt
tctggtgttgtaaaacggaaaattcgtgatatttttggcgcagagctagatgatgcagag
attaattcacttagtacactgatttattatccagaagaaaagatggatttgattgctagt
gaaacagaagatttgcatgcttggtatcgcaccacactttttcgtttgattgaactctgc
cagtatgttgcttcaaaatacacacgttctaaagttagaaaagccatgccagaagatttt
gcctacatattagaagagttacttcatgaaaactacaatgaagacgataaaaagctttat
tatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagcgct
ctctcgctacttattcaacaattggtcgtggatcatttgcacattgttggtgatgtttat
gatcgtggcccttatccagataaaatcatggatacattaatgaattaccattcgctcgat
ttccagtggggtaatcacgatattttatggatgggcgcggctagtggctctagggtttgt
gcggctaatgttattcggatttctgctcgctatttaaatttagatattttagaagatagt
tacggtatttcccttcgccccctagccctttttgccgacgaagtgtacaaagacgatcct
tgtacctacttccagccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacg
caaattgctaggatgcacaaggctatctcgattattcagtttaaattggaaggtgaaatt
attaaccgacgcaaagaatttgatatgaatcatcggcttttacttcaatttatcgattac
aaaaaaggcacaattcaactaaaaggaaaagaataccagttgttagacaatcattttcca
acgattaatccagaaaatccttatgaacttactgatgcggagagagaacttattgggaaa
attactgccgcttttaaaaactgccgccgattgcaaaaacatgtacaatttctatattca
aaaggcagcatgtttttaacttataatggcaatttactctaccatggctgcattccgctc
cacgaagatgggacttttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcg
cttttagagcagtttgaaatacttacccgcgaagcatacgtccgcccaactggaacaaaa
gaaaagaaatatgcgtgtgatatcgtttggtatttgtggactggtgccatttcttcgcta
ttcggaaaaagtgaaatgactacgtttgaacgttattttgttgcagaaaaagaaacccac
acagaggaaaaaaatccttattataaattgcgtaataacgaattaatttgcaaacaaatt
ttagaagaatttgagcttgacggagaatgcgggcatatcattaacggccatacgccagtc
aaagaaggaaaaggtgaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggc
gggttcgcaaaagcatatcataaagagacaaacttagcgggttatacactacttttcaac
agttacggtttacaactagttagtcatcagccatttactacaaaagaggatgctatcaaa
aatgaaacggatattctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgt
gtaagggataccgatattggggctaaacttagtgaacaggcagaagatttaaaattgcta
ctagatgcttatcgtaatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system