KEGG   Listeria monocytogenes Finland 1998: LMLG_2730Help
Entry
LMLG_2730         CDS       T01986                                 

Definition
(GenBank) RecD/TraA family helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lms00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMLG_2730
Enzymes [BR:lms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LMLG_2730
DNA repair and recombination proteins [BR:lms03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LMLG_2730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA_16 AAA_12 AAA_22 NTPase_1 UvrD-helicase T2SSE AAA_17 UvrD_C AAA_18 AAA AAA_28 Zeta_toxin TsaE ABC_tran AAA_29
Motif
Other DBs
NCBI-ProteinID: AEO39038
Position
complement(1520106..1522502)
Genome map
AA seq 798 aa AA seqDB search
MAEQESLALFDDTTEELFMKGTMLSTIFYNAENLFSVVRILVKETNADWDEKDIIVTGFF
PALHEQEVYTFYGKMQEHAKFGQQFKADRFRKEMPQSRAGLINYLSGELFKGIGKVTAEN
IVDTIGDDAITKILSDPSLLNTVPKLPSGAAESLLASLRENQGLEHVMVGLNEYGFGPQL
SMKIFQAYKQNAIEVLENNPYKLIEDVKGIGFQRADELGRKLCLGGNHPERLRAGILFML
DSVCMQQGHVYMEQEVLLGEVTYLLEESEGIRIDQSILVAQVEKLAEEQKIITENTRVYM
PSLYYSESGFAYHVKRMLKQTEYQEQFPQSEFLLALGELEERIGVHYGDSQRQALEQALM
SPMLVLTGGPGTGKTTVIKGIVELYAELNGVSLDPHAYKDGATFPVLLAAPTGRAAKRMS
ESTGLPAMTIHRLLGMNGQEQMDDDAERLIDGRLLIVDEMSMVDIWLANQLFRALPAHMQ
VVLVGDQDQLPSVGPGQVLKDILQSEQIPTVALSDIYRQKDGSSIIEMAHYIKEGMLPAD
FTKNSADRSFFHCTVNQIGDVVEQVVKNAKNKGFRAKDIQVLAPMYRGPAGIDILNKKLQ
EIFNPNDTGRRKEVQFGDIKYRVHDKVLQLINQPEKNVFNGDIGEIVSIIYAKENTEKQD
LIVVQFDQTEVSYYRQEFNQLTHAYCCSIHKAQGSEFPIVIMPIVRSYYRMLRRDLLYTG
VTRSKQFLILCGEEEAFRMGIERIDENKRNTTLSERLMSEDVLLEQMTNKRILTAENITE
IDPMIGMEGITPEQFMVG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagaatcactcgccttatttgatgatacaacagaagaacttttcatgaag
ggcacgatgttgtctaccattttttacaatgccgaaaacctcttttctgtcgtacgaata
ttggtaaaagaaacaaatgcggattgggacgaaaaagatattatcgtaactggctttttc
ccagcactccacgaacaagaagtctacactttctacggaaaaatgcaggaacatgctaaa
tttggtcaacaattcaaagcagaccggtttcgtaaagaaatgccacaatcacgcgctggt
ttaattaattatctttctggagaactttttaaaggaattggtaaagtaaccgctgaaaat
attgtggatacgattggcgatgatgctattacgaaaattttatccgatccgagtttgtta
aacacggtacctaagttgccatccggtgcagcggaaagtttgcttgcttcccttagagaa
aatcagggattagagcatgtgatggtcggtttaaacgaatatggctttggcccgcaatta
tccatgaaaattttccaggcctataaacaaaatgctattgaagtgttagagaataatcct
tataaattgattgaggacgtaaaagggattggttttcagcgtgccgatgagcttggacgg
aaactctgtcttggcgggaatcatccagaacggcttcgcgcagggattttatttatgtta
gattcggtttgtatgcaacaaggtcacgtatacatggagcaagaggttctgcttggagaa
gtgacatatttgctagaagaaagtgaaggcattcgaattgaccaaagtattttagtagct
caagtagaaaaattggccgaggaacaaaagattattacggaaaacacacgcgtatacatg
ccatcgctctattattcagagagtggctttgcatatcatgtgaagcgaatgcttaaacaa
acagaataccaagaacaatttccacaatccgaatttttactagctctaggagaattagaa
gaaaggattggcgttcattacggagactcacaacgacaggctttagaacaagctttaatg
tctccgatgctcgtacttactggtggtcctggaacagggaaaacaacggtcattaaaggg
atagtggagctgtatgcggaactaaatggtgtgagtcttgatccccatgcttacaaagat
ggagcgactttccccgttcttcttgctgctccaactggtcgtgccgctaaacggatgtca
gagtcaactggacttcctgcgatgactattcaccgtctactcggaatgaatggtcaagaa
caaatggatgatgatgcagaaagactgattgatggacgactgttgattgtggatgagatg
tcgatggttgatatttggcttgctaatcaattattccgtgctttaccagcgcacatgcaa
gtggtactcgttggcgaccaagatcagttgccttcagtcggaccgggtcaagtactcaaa
gatattctgcaatctgaacaaattccaactgtagctctttcagatatttatcgccaaaag
gatggttcttccattatcgaaatggcgcattatataaaagaaggcatgttgccagctgat
ttcaccaaaaatagcgccgatcgctccttttttcattgcacggtaaatcaaattggtgat
gtggtcgaacaagtggtaaaaaatgcaaaaaacaaagggtttcgagcaaaagatatccaa
gttttagcaccaatgtatcgtggtcccgcaggcattgatattttaaataaaaaactacaa
gaaatcttcaatccaaatgatacagggcgtcgtaaagaagttcaattcggtgacataaag
tatcgcgtgcatgacaaagtactgcaattgattaatcaaccagagaaaaatgtgtttaac
ggtgatatcggtgaaattgtttctataatctacgccaaagaaaataccgaaaaacaagat
ctgattgtcgttcaatttgaccaaacagaggtttcttactataggcaagaatttaatcaa
ttgacccatgcttattgttgttcgattcataaagcgcagggaagtgaatttccgattgtg
attatgccgattgtccgcagttactaccggatgttacgtcgcgatttactctacactgga
gtaacgcggagtaaacaatttctcattctttgcggggaagaagaagcttttcgaatgggg
atagaacgaattgatgaaaataagcgtaatacaacactctctgaacgtttaatgagcgaa
gatgttttattagaacaaatgacgaataaacgaattctcactgctgaaaacattacggaa
attgatccgatgattggaatggaagggattactccagaacagtttatggtaggataa

DBGET integrated database retrieval system