KEGG   Listeria monocytogenes Finland 1998: LMLG_2767Help
Entry
LMLG_2767         CDS       T01986                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMLG_2767
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMLG_2767
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMLG_2767
Enzymes [BR:lms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMLG_2767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2560236..2561291)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIAQGKPIDNPETIATAIRI
GNPASWGLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacgcca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
cttggggttactttatacggaaaatacgaaggcttaaatccaaccggttcttttaaagat
cgtggaatggttatggctgttgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tatggcgcagatattatctcgattcaaggtaattttgatgaagcattaaaatcggttcgt
gaattagctgaaacagaagcagtaacacttgtaaattccgtgaatccatatcgtttagaa
ggtcaaaaaacagctgcattcgaaatctgtgagcaattaggttccgcgccagatgtactt
gcaattccagtcggtaatgccgggaatatttctgcatactggaaaggatttaaagagtgg
aatgaggctaaggcttctggacttccacggatgcatggttttgaagcggaaggtgcggcg
gcgattgctcaaggtaaaccgattgataatccggaaacaattgccacagcgattcgtatc
ggaaatccagctagttgggggcttgcagaagcagctcgcgatgaatctggcggatatatc
cattctgtaacagatgatgaaattgttaatgcgtataaaaaaatcgcagcgcaagatggt
gtcttcatcgagccaggttctgccgcttcattagctggtgtcattcaacatgtagcaaat
ggaacaattaaaaaaggcgaaacagttgtttgtgtctttactggaaacggcttaaaagac
ccggatactgcgatgagtgtccatgaaattccgatttcccatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system