KEGG   Listeria monocytogenes Finland 1998: LMLG_2916Help
Entry
LMLG_2916         CDS       T01986                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LMLG_2916
Enzymes [BR:lms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LMLG_2916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237977..238393
Genome map
AA seq 138 aa AA seqDB search
MAKAFLSIGTNIGERLENLNDALRGLAASNQINITNVSSVYETDAVGYEDQAAFLNIAVE
IETDFPPIDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDVKTDTEKLKIPHPYMKE
RAFVMIPLIEISPEKAIL
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcgtttctatcaattggcacaaatattggcgagcgtttagagaatttaaat
gacgcactaagaggtttagcggcttcgaatcaaattaatatcaccaacgtatctagcgta
tacgaaacagatgcagtaggttacgaagatcaagcagcatttttaaatatcgctgtagaa
attgaaacggactttccgccaattgatttattagatttttgccttgcgctcgaacttgaa
ttggggcgagttcgattatttaagtggggtccgcgactcattgatattgatgttttatta
tatgatgatgttaaaaccgatacagaaaagctaaaaatcccacatccttatatgaaagaa
cgtgcttttgtgatgattccattaatagaaatttcaccagaaaaagcaatcttgtag

DBGET integrated database retrieval system