KEGG   Listeria monocytogenes Finland 1998: LMLG_2963Help
Entry
LMLG_2963         CDS       T01986                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMLG_2963
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_2963
   00020 Citrate cycle (TCA cycle)
    LMLG_2963
   00620 Pyruvate metabolism
    LMLG_2963
Enzymes [BR:lms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMLG_2963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1083668..1085290
Genome map
AA seq 540 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAPAQASGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEDAALANSAPATGGNGTPSSKKDPNGLVIAMPSVRK
YAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAAATTTAQTEEKAAAPKAEKAAAKQ
PVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKEVAAE
KGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYVPVIK
NADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYPEVAI
LGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELLLMEV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataaaattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacaattaaagaaatcaaa
gttgctgaaggtacagttgctacagttggacaagtactagtaacgtttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaatccacagaatca
actcctgcacccgcacaagctagcggaaaaggaatttttgaattcaaattaccagatatt
ggtgaaggaattcatgaaggtgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtacaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggtactgttaaagatattttagttagcgaaggaacagtagcaacagttggt
caagtattagtaacattcgaaggtgattttgaaggagaagcaagccatgaatctactcca
gaatctccagcagaagacgctgcacttgctaactccgcaccagcaacaggtggaaacgga
actccatcatctaaaaaagatcctaatggccttgtaattgcaatgccttctgtacgtaaa
tatgcgcgtgaaaaaggcgttaatatcgctgaagtagcaggctctggaaaaaataaccgc
gtagttaaagctgatattgatgctttcctaaacggcgaacaaccagctgcagcaacaact
actgctcaaacagaagaaaaagcagctgcaccaaaagcagaaaaagcagcagcaaaacaa
ccagttgcaagctccgatgcttacccagaaacacgcgaaaaattaacaccaactcgtcgt
gcgattgcaaaagcaatggtaaactcaaaacatacagctccacacgttactttaatggac
gaaatcgaagtaactgcacttatggctcaccgcaaacgtttcaaagaagtggctgccgaa
aaaggtatcaaacttactttcttaccttacatggtgaaagctcttgttgcaacgcttcgt
gacttcccagtgcttaacacaactttagatgatgcgacagaagaacttgtttacaaacat
tacttcaacgttggtatcgcagcagatacagaccacggtttatatgtaccagtaattaaa
aatgctgataaaaaatcggtattccaaatttctgatgaaatcaacgaactagctggaaaa
gcacgtgatggtaaattaactgctgacgaaatgcgccacggttccgcaactatttctaat
atcggttctgccggcggacaatggttcactccagtaattaattacccagaagttgctatt
ctaggtgttggtcgtattgctcaaaaacctatcgtaaaagatggcgaaattgtagcagca
ccagtactagctctttccttgagctttgaccaccgtgtaattgacggcgcaactgctcaa
aaagcaatgaacaatattaaacgtttattaaacgatccagaattattactaatggaggtg
taa

DBGET integrated database retrieval system