KEGG   Listeria monocytogenes Finland 1998: LMLG_2994Help
Entry
LMLG_2994         CDS       T01986                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LMLG_2994
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMLG_2994
Enzymes [BR:lms01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LMLG_2994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1896355..1897266)
Genome map
AA seq 303 aa AA seqDB search
MKNLLSMEALTVHEIEHLLEQAAQFKRGKKATFNEQTFAVNMFFEPSTRTHTSFEVAEKK
LGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEENYYAGLEKLDIAIVNGG
DGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANSNMKVLKRLGAELFFSGP
REWFDESYLAYGTYLPVDEIVEKVDVMMLLRVQHERHSGTDEFTKESYHEKFGLTEDRAK
KLKEDAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVFIRMAILEAILKEQEMRAKL
CTY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgttgtcaatggaagcattaaccgtccatgaaatcgagcatttattagag
caggcggcacagtttaaacgcgggaaaaaagcgacttttaatgaacagactttcgcggtc
aatatgttttttgaaccaagtacgagaacacatacgagttttgaagtagcggagaaaaag
ttaggcgtggaggttgtttcttttgatgcagcgagctctagcatgacaaaaggagaaacg
ctctacgatacactgctcacgatgcaagccgtaggggtcaatgtcgcagtaattagacac
tcagaagaaaattactatgcgggactcgaaaaattagacattgctattgtgaacggcggt
gatggatgcggtgaacaccctagtcaatcactacttgacttattcacgataaaagaacaa
tttggtacttttcagggtttgaaagtagcgattgctggtgatattcggcacagtcgagtt
gccaattccaatatgaaagtgttaaaaagacttggcgcggaactgtttttctctggacca
agagaatggtttgacgaaagttacttagcatatggcacatacttaccagttgatgaaatt
gtggaaaaagtggatgtaatgatgcttttgcgtgtacaacatgagcgccatagtggaaca
gatgagtttacgaaagaaagctaccacgaaaaatttggattgacggaagatcgggcaaag
aagttaaaagaagatgcaatcattatgcatccaagccctgtgaaccgagatgtggaaatc
gctgatagtttagtagaaagcgaaaaatcacgcattgttacgcaaatgacaaatggcgtt
tttataagaatggccattttggaagctattttaaaagaacaggaaatgagggcgaaatta
tgtacgtattaa

DBGET integrated database retrieval system