KEGG   Listeria monocytogenes 10403S: LMRG_00037Help
Entry
LMRG_00037        CDS       T01984                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMRG_00037
   01230 Biosynthesis of amino acids
    LMRG_00037
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMRG_00037
   00051 Fructose and mannose metabolism
    LMRG_00037
   00562 Inositol phosphate metabolism
    LMRG_00037
Enzymes [BR:lmt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMRG_00037
Exosome [BR:lmt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMRG_00037
  Exosomal proteins of bladder cancer cells
   LMRG_00037
  Exosomal proteins of melanoma cells
   LMRG_00037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(374425..375189)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLSANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNVVLAYEPEWAIGKANSAD
TDYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatatcaatactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttggaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgactgccaaccttttagcggggacatcattt
ggttttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatcaatcattgatctaagcgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcaaagaaaatcaaactcgcgctggatgaa
aaaatcactcctgtagtatgtgtgggtgaaggcattcgcgcaaatgatacgaacgaatta
aaaaatgcgcttaaaaagcaaatcgaagcgctatttgacactattcaagtaacacaattt
aaaaatgtcgttctggcttatgaaccggaatgggcaattggcaaggcaaattccgctgac
acagactacatcgaaagcgctcatcaagctttgcgtgaaattattcgcgaactaggcggt
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system