KEGG   Listeria monocytogenes 10403S: LMRG_00544Help
Entry
LMRG_00544        CDS       T01984                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LMRG_00544
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMRG_00544
Enzymes [BR:lmt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LMRG_00544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098335..1098895
Genome map
AA seq 186 aa AA seqDB search
MEIVESKLAGVKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFIQDNHSLSVEAGVLRG
MHYQTNPKAQTKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHG
FCTITENVNVLYKVDQLYSPENDAGIAYDDPDLNITWPTDKLILSDKDTKHPRLKDAENN
FVWENK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgaaagtaaactagctggtgttaaattagtaaaaccaaaagtgtttgga
gatcatcgtggttttttcatggaaagctataatgaaaaagcattccatgaagctggaatc
gatatgaagtttattcaagataaccactctctttctgtggaagcgggtgtacttcggggt
atgcattatcaaacgaacccaaaagcacagacaaaattaattcgtgttgcgacaggcgca
atttatgatgtagttgttgatatgcgtaaaggttctcctacatacggtgagtgggaaggt
tatattttaagcgaagcaaacaaacatcaacttctagtaccacaaggatttgctcatggc
ttttgtacgattaccgaaaatgtgaatgtgctttataaagtagatcaattatattcccct
gaaaacgatgcgggaattgcctacgatgatccggatttaaatattacttggccaacagat
aaattaattttatcggacaaggatacgaaacatccacgtttaaaagacgctgaaaataat
tttgtatgggagaataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system