KEGG   Listeria monocytogenes 10403S: LMRG_00985Help
Entry
LMRG_00985        CDS       T01984                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LMRG_00985
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMRG_00985
Enzymes [BR:lmt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LMRG_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1871682..1872593)
Genome map
AA seq 303 aa AA seqDB search
MKNLLSMEALTVHEIEHLLEQAAQFKRGKKATFNEQTFAVNMFFEPSTRTHTSFEVAEKK
LGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEENYYEGLENLDIAIVNGG
DGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANSNMKVLKRLGAELFFSGP
REWFDESCLAYGTYLPVDEMVEKVDVMMLLRVQHERHSGTEAFTKESYHEKFGLTIERAA
KLKADAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVFIRMAILEAILKEQEMRAKL
CTY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgttgtcaatggaagcattaaccgtccatgaaatcgagcatttattagag
caggcggcacagtttaaacgcgggaaaaaagcgacttttaatgaacagactttcgcggtc
aatatgttttttgaaccaagtacgagaacacatacgagttttgaagtagcggagaaaaag
ttaggagtcgaggtggtttcctttgatgctgcgagctctagcatgaccaaaggggagacg
ctctacgacactctgctcaccatgcaagcagttggagtgaatgtggcagtaatcaggcat
tcagaagaaaactattacgagggtcttgaaaacttagatattgctattgtaaacggcggg
gatggctgtggggaacatccgagccaatcattactcgacttatttacgataaaggagcaa
tttggtacttttcaagggttgaaagtagcgattgctggtgatatcaggcacagccgagtc
gccaattccaatatgaaagtgctaaaaagacttggagcggaactgtttttctcgggaccg
agagaatggtttgacgaaagttgcttagcatatggcacctacttgccggtcgatgagatg
gtagaaaaagttgatgtgatgatgctattacgggtacaacatgagcgccatagtggaaca
gaggcgtttacgaaagaaagctatcacgaaaaatttggtttaacgattgagcgggcggca
aagctaaaagcagatgcgattattatgcacccaagtcctgtaaaccgagatgtggaaatc
gctgatagcttagttgaaagcgaaaaatcacgcattgttacgcaaatgacaaatggcgtt
tttataagaatggccattttggaagctattttaaaagaacaggaaatgagggcgaaatta
tgtacgtattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system