KEGG   Listeria monocytogenes 10403S: LMRG_01332Help
Entry
LMRG_01332        CDS       T01984                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
lmt00010  Glycolysis / Gluconeogenesis
lmt00071  Fatty acid degradation
lmt00350  Tyrosine metabolism
lmt00620  Pyruvate metabolism
lmt00625  Chloroalkane and chloroalkene degradation
lmt00626  Naphthalene degradation
lmt00650  Butanoate metabolism
lmt01100  Metabolic pathways
lmt01110  Biosynthesis of secondary metabolites
lmt01120  Microbial metabolism in diverse environments
lmt01130  Biosynthesis of antibiotics
lmt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMRG_01332
   00620 Pyruvate metabolism
    LMRG_01332
   00650 Butanoate metabolism
    LMRG_01332
  Lipid metabolism
   00071 Fatty acid degradation
    LMRG_01332
  Amino acid metabolism
   00350 Tyrosine metabolism
    LMRG_01332
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LMRG_01332
   00626 Naphthalene degradation
    LMRG_01332
Enzymes [BR:lmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LMRG_01332
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LMRG_01332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AEO06620
UniProt: A0A0H3GKP8
Position
1636337..1638937
Genome map
AA seq 866 aa AA seqDB search
MAIKENAAQEVLEVQKVIDRLADNGQKALKAFESYNQEQVDNIVHAMALAGLDQHMPLAK
LAVEETGRGLYEDKCIKNIFATEYIWNNIKNNKTVGVINEDVQTGVIEIAEPVGVVAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQRCSSAAAKVVYDAAIAAGAPEHCIQWVE
KPSLEATKQLMNHDKVALVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRSV
NDIILSKSFDQGMICASEQAVIVDKEVAKEVKAEMEANNCYFVKGAEFKKLESYVINPEK
GTLNPDVVGKSPAWIANQAGFKVPEDTKILVAEIKGVGDKYPLSHEKLSPVLAFIEAANQ
AEAFDRCEEMLVYGGLGHSAVIHSTDKEVQKAFGIRMKACRIIVNAPSAQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIADRRNNMQWFKLPPKIFFEKYSTQYLQKM
EGVERVFIVTDPGMVQFKYVDVVIEHLKKRGNDVSYQVFADVEPDPSDVTVYKGAELMKD
FKPDTIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGGKAKFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVTTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSIRAIELVFENLRESVLTGDPDAREKMHNASALAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNALKPKKHALFPRYESFRADEDYAR
ISRIIGFPAATTEEGVKSLVDEIIKLGKDVGIDMSLKGQNVAKKDLDAVVDTLADRAFMD
QCTTANPKQPLVSELKEIYLEAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaaatgcggcccaagaagtattagaagttcaaaaagtgattgacaga
ttagcagacaatggacaaaaagcattgaaagcatttgaaagttacaaccaagaacaagta
gacaatatcgttcacgcaatggcacttgccggacttgaccaacatatgccccttgcaaaa
ttagcagtagaagaaactggacgtggattatacgaagataaatgtattaaaaacatcttc
gcgacagaatatatttggaacaacattaaaaacaataaaacagtcggagttattaacgaa
gacgtacaaactggtgtgattgaaattgctgaaccagttggcgttgttgccggtgttaca
cctgtaactaacccaacatctactactcttttcaaagcaattatcgcgattaaaacgcgt
aacccaatcatctttgctttccatccaagtgcacaacgttgttcatcagcagcagcgaaa
gttgtatatgatgcagcaattgcagctggagctccagaacattgtattcaatgggtagaa
aaaccttccctagaagcaacaaaacaattaatgaaccatgataaagttgcacttgtactt
gcaactggtggtgctggaatggttaaatcagcatactctactggtaaacctgcactaggt
gttggaccaggtaacgtaccagcttacattgacaaaacagctaaaatcaaacgttctgtt
aatgacatcattctttctaaatcttttgaccaaggtatgatttgtgcttctgaacaagca
gtaatcgtagacaaagaagtggctaaagaagtaaaagcagaaatggaagcaaacaactgc
tacttcgttaaaggagctgaattcaaaaaattagaaagctatgttatcaaccctgaaaaa
ggaacacttaacccagatgtagttggtaaatcccctgcatggattgcaaaccaagctggc
ttcaaagttccagaagatacaaaaattcttgtagctgaaattaaaggtgttggcgacaaa
tacccactatctcacgaaaaattaagcccagttcttgcatttatcgaagctgctaaccaa
gcagaagcattcgatcgttgtgaagaaatgttagtatatggaggacttggacactccgca
gttattcactctactgataaagaagttcaaaaagcatttggtatccgtatgaaagcttgc
cgtatcattgtaaacgcaccaagcgcacaaggcggtatcggtgacatttataacggcttc
atcccttccctaacacttggttgtggatcttatggtaaaaactctgtatcacaaaatgta
agtgcgactaacttgctgaacgttaaacgtatcgcggatcggagaaataatatgcaatgg
ttcaaacttccaccaaaaattttctttgaaaaatattccactcaataccttcaaaaaatg
gaaggcgttgaacgcgtatttatcgtaactgacccaggaatggttcaattcaaatatgtt
gatgttgtaatcgaacacttgaaaaaacgtggcaatgacgtatcttaccaagtatttgct
gacgttgaaccagatccatctgacgtaacagtttataaaggtgcagaactaatgaaagac
ttcaaaccggacacaattatcgctcttggtggtggttccgcaatggatgctgccaaaggt
atgtggttattctatgaacacccagaagcttcattcttcggcttgaaacaaaaattctta
gatattcgtaaacgtactttcaaatatcctaaacttggtggaaaagcaaaattcgtcgca
attccaacaacaagtggtacaggttctgaagtaacaccttttgcggttattacagacaaa
gaaaataacattaaataccctcttgctgactacgaattaactccagacgttgcgattgtc
gatgcacaatatgtaactactgttccagcacacattactgctgatactggtatggacgtt
ttaactcacgcaattgaatcttatgtatccgtaatggcaagcgattatactcgtggatta
tctatccgcgcaatcgaacttgtttttgaaaacttacgtgaatctgttcttactggtgat
ccagatgcgcgcgaaaaaatgcataatgcttctgccctagctggtatggcgtttgcaaat
gcgttcctaggaatcaaccacagcttggcacacaaaattggacctgaattccacattcct
cacggtcgtgcgaatgcaatccttatgccacatgttattcgttataacgcacttaaacct
aaaaaacatgcgttattcccaagatatgaaagtttccgtgctgatgaagattatgctcgt
atctctcgtattatcggcttccctgctgcaactacagaagaaggcgttaaatcacttgta
gatgaaatcatcaaacttggtaaagatgttggtatcgacatgagtcttaaaggacaaaat
gttgctaaaaaagatttggatgctgttgtagatactcttgcagatcgcgcattcatggac
caatgtactacagccaaccctaaacaacctcttgtaagtgaactaaaagaaatctacctt
gaagcttacaaaggtgtttga

DBGET integrated database retrieval system