KEGG   Listeria monocytogenes 10403S: LMRG_01338Help
Entry
LMRG_01338        CDS       T01984                                 

Definition
(GenBank) tryptophan synthase
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
lmt00260  Glycine, serine and threonine metabolism
lmt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmt01100  Metabolic pathways
lmt01110  Biosynthesis of secondary metabolites
lmt01130  Biosynthesis of antibiotics
lmt01230  Biosynthesis of amino acids
Module
lmt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMRG_01338
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMRG_01338
Enzymes [BR:lmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMRG_01338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1598
Motif
Other DBs
NCBI-ProteinID: AEO06614
UniProt: A0A0H3GD34
Position
complement(1629731..1630933)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYQASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMKCTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDASVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASKMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggtagatttgta
ccagaaacattaatgaaagcagtgaaagaattagatgaggcgtaccaagcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgccgaacaactaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaacaatactattggtcaagcctta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggtgcgggtcaacacggc
gtggcaacagcaactgttgcagcgctttttaatatgaaatgtactatttttatgggagaa
gaagatgtaaaacgtcaatcactcaatgtatttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagatgcagtaaatgaagcgcttaggttc
tgggttgcaaatgtggaagatacgcattacattatgggatctgttcttggaccacaccca
tttccagaaatcgttcgtgattaccaaagtgtaataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgtagcttgtgttggaggcgggagtaat
gcgatgggcttattttatccatttgtagacgatgcttctgttcaaatgcacggtgtggaa
gcagctggtcacggtttagagacagaattccacgcagcaaccatttccaaaggagaaatt
gggattttacacggagcgatgatggatgtattacaagatgagaatgggcaaattttggaa
gcattttcgatttctgctggcttagattatccgggtattggtccagagcatagctttttc
cgtgatttaggtcgcgcagcgtatcattctgttactgatgatgaagcagtcgaagccttt
caacttttatgtcgtacggaaggaattattccagcgctcgaaagttctcacgcaattagc
tatgcggttaaacttgcaagtaaaatgcgtccagaagaaagtatggttgtttgtttatct
ggtcgcggagacaaagacgttaaccaactaaaagaacgtttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system