KEGG   Listeria monocytogenes 10403S: LMRG_01396Help
Entry
LMRG_01396        CDS       T01984                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMRG_01396
   01230 Biosynthesis of amino acids
    LMRG_01396
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMRG_01396
   00030 Pentose phosphate pathway
    LMRG_01396
   00051 Fructose and mannose metabolism
    LMRG_01396
   00052 Galactose metabolism
    LMRG_01396
  Energy metabolism
   00680 Methane metabolism
    LMRG_01396
Enzymes [BR:lmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMRG_01396
Protein phosphatases and associated proteins [BR:lmt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMRG_01396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1569120..1570079)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgcgctgttgtacggaaagcaatctatgaaggactcgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaattagaattaggttctgttggtgattta
cttcaccgcgggggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagttgttatc
ggtggagatggttcttatcacggagcggaagcacttacaaaacgcggattcccaactatt
ggtatcccaggaacaattgataatgatatttctggaactgattttactattggttttgat
actgcattaaatactgttcttgatgcacttgataaaatccgcgatacagctacaagtcat
gaacgtactttcattattgaagttatgggtcgcgacgctggtgatatcgctctttggtct
ggtcttgctggtggcgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggcaaaaaacatagtattatcgtcgta
gctgaaggcgtaatgtctggtaatgaattcgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagccgtcttggtgcgcgttcagtagaattattgttagaaaatcgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgaaattttg
aaagaaaaacacacacttgatcaaaaattatttgatctagcatcaattttgtcgatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system