KEGG   Listeria monocytogenes 10403S: LMRG_01413Help
Entry
LMRG_01413        CDS       T01984                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMRG_01413
Enzymes [BR:lmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LMRG_01413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1550363..1551085)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREASKNKPWQTYFSQNGYEVMSIPLIKTQPIKINLSREQQETDWLFLTSANA
VEYFFTNQYERSNYKIAVIGEKTKEKLAEFGHEPSFVPSIYQSEVFLEEWLNENPEKTSI
LLPQSNLSRTIIKDTLIEKGYIVFSIELYETIFPEASKKLLTEQLKLNETQIIVFASPSA
WKNFYSIAKSFPAQKEKWHIASIGSITTEAILADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgagtaaaaacaaaccatggcaaacctat
ttttcacaaaatggttatgaggtgatgtccatcccgcttattaaaacacaacctataaaa
attaatttgagccgagaacaacaagaaacagactggctttttttaacaagtgctaatgct
gtagaatatttcttcacgaaccaatatgagagatccaattacaaaatagctgtcatcggc
gaaaaaacaaaagaaaagttggcagaatttggtcacgaaccaagttttgtcccatctatc
tatcagtcagaagtatttttagaagaatggttaaacgagaacccagagaaaacaagtatc
ttactaccacaaagtaatttaagcagaacaataataaaagatacattgatagaaaaaggt
tatatcgttttttcgattgagctctacgaaacaatttttccagaggcttctaaaaaactg
ttaaccgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccatcgcgaaatcattccctgctcaaaaagagaagtggcatatc
gcatcaattggtagtattacaacagaggccattctagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system