KEGG   Listeria monocytogenes 10403S: LMRG_02142Help
Entry
LMRG_02142        CDS       T01984                                 

Definition
tRNA pseudouridine synthase A
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
lmt  Listeria monocytogenes 10403S
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2648245..2648991)
Genome map
AA seq 248 aa AA seqDB search
MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRVTASGRTDTGVHAKG
QVIHFDSELDITAEKFQKALQVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRTKI
FDPFSRNFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYEED
DETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISEALLARDRQKLISKTAPPQGL
YLWRVDYE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacaagatataaagcgataatttcttatgatggtagtgggttttatggctatcaggtg
cagccgaatacacgtacggtccaagcggaaattgaaaaagcactgacaaaaatgcataaa
ggtaagactgtgcgggttacagcatcgggaagaacagatactggtgttcatgcgaaaggt
caggttattcatttcgattcggaactggatatcactgccgaaaaattccaaaaagcttta
caagtcatgaccccgtttgatattagctttttaacagtggaagaagtaccagacgatttc
catgctagatttggcacggtcggaaaagaatatcgttatgtggtaaaacggacgaaaatt
tttgatccttttagtcggaattttgcgctacattatccgtatgaactggatatttcaaaa
atgaaattggcgagtaaacgcctgattggcgagcatgattttacaagtttctgttcggcg
agaacggagcgggattctaaagtccggacgctttatagtattgatttttatgaagaggac
gatgagacgttagtgattgcttttcaagggaatggctttttgtataatatggtgcgaatt
ttgactggaactctgctcgatgcagggcaaggtcgaatctctccggatgatattagtgag
gctttattagcacgtgataggcaaaaattaattagtaaaactgcgccgccacaagggtta
tatttatggcgagtcgactatgaataa

DBGET integrated database retrieval system