KEGG   Listeria monocytogenes 10403S: LMRG_02253Help
Entry
LMRG_02253        CDS       T01984                                 

Definition
(GenBank) fructose-1,6-bisphosphatase class 3
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
lmt00010  Glycolysis / Gluconeogenesis
lmt00030  Pentose phosphate pathway
lmt00051  Fructose and mannose metabolism
lmt00680  Methane metabolism
lmt01100  Metabolic pathways
lmt01110  Biosynthesis of secondary metabolites
lmt01120  Microbial metabolism in diverse environments
lmt01130  Biosynthesis of antibiotics
lmt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMRG_02253
   00030 Pentose phosphate pathway
    LMRG_02253
   00051 Fructose and mannose metabolism
    LMRG_02253
  Energy metabolism
   00680 Methane metabolism
    LMRG_02253
Enzymes [BR:lmt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LMRG_02253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: AEO05829
UniProt: A0A0H3GAG3
Position
complement(840714..842675)
Genome map
AA seq 653 aa AA seqDB search
MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNG
SGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELC
QYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISA
LSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVC
AANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEIT
QIARMHKAISIIQFKLEGEIINRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFP
TINPENPYELTDVERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPL
HKDGTFMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSL
FGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPV
KEGKGESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIK
NETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactattgatatgaaatatttacgcttgttagcaaaagaatatcctactatcgcc
aagacagctacggaaatcattaacctcgaagcaattatgaaccttccaaaaggaacggaa
cattttttaagtgatgttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggt
tctggtgttgtaaaacggaaaattcgtgatatttttggcgcagagctagatgatgcagag
attaattcacttagtacactgatttattatccagaagaaaagatggatttgattgctagt
gaaacagaagatttgcatgcttggtatcgcaccacactttttcgtttgattgaactctgc
cagtatgttgcttcaaaatacacacgttctaaagttagaaaagccatgccagaagatttt
gcctacatattagaagagttacttcatgaaaactacaatgaagacgataaaaagctttat
tatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagcgct
ctctcgctacttattcaacaattggtcgtggatcatttgcacattgttggtgatgtttat
gatcgtggcccttatccagataaaatcatggatacattaatgaattaccattcgctcgat
ttccagtggggtaatcacgatattttatggatgggcgcggctagtggctctagggtttgt
gcggctaatgttattcggatttctgctcgctatttaaatttagatattttagaagatagt
tacggtatttcccttcgccccctagccctttttgccgacgaagtgtacaaagacgatcct
tgtacctacttccagccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacg
caaattgctaggatgcacaaggctatctcgattattcagtttaaattggaaggtgaaatt
attaaccgacgcaaagaatttgatatgaatcatcggcttttacttcaatttatcgattac
aaaaaaggcacaattcaactaaaaggaaaagaataccagttgttagacaatcattttcca
acgattaatccagaaaatccttatgaacttactgatgtggagagagaacttattgggaaa
attactgccgcttttaaaaactgccgccgattgcaaaaacatgtacaatttctatattca
aaaggcagcatgtttttaacttataatggcaatttactctaccatggctgcattccgctc
cacaaagatgggacttttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcg
cttttagagcagtttgaaatacttacccgcgaagcatacgtccgcccaactggaacaaaa
gaaaagaaatatgcgtgtgatatcgtttggtatttgtggactggtgccatttcttcgcta
ttcggaaaaagtgaaatgactacgtttgaacgttattttgttgcagaaaaagaaacccac
acagaggaaaaaaatccttattataaattgcgtaataacgaattaatttgcaaacaaatt
ttagaagaatttgagcttgacggagaatgcgggcatatcattaacggccatacgccagtc
aaagaaggaaaaggtgaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggc
gggttcgcaaaagcatatcataaagagacaaacttagcgggttatacactacttttcaac
agttacggtttacaactagttagtcatcagccatttactacaaaagaggatgctatcaaa
aatgaaacggatattctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgt
gtaagggataccgatattggggctaaacttagtgaacaggcagaagatttaaaattgcta
ctagatgcttatcgtaatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system