KEGG   Listeria monocytogenes 10403S: LMRG_02447Help
Entry
LMRG_02447        CDS       T01984                                 

Definition
(GenBank) beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
lmt00010  Glycolysis / Gluconeogenesis
lmt00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMRG_02447
   00500 Starch and sucrose metabolism
    LMRG_02447
Enzymes [BR:lmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMRG_02447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AEO05039
UniProt: A0A0H3G8T4
Position
21653..23086
Genome map
AA seq 477 aa AA seqDB search
MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGRWEALFNPSKALATDY
GFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGDETTPNEKGLAFYDAVF
DECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFCEAIFTRYKDKVKYWMTF
NEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALATKLGHEINPENQIGCMLA
AGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTKRFFKEHNINIKMEDGDLDA
LRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNPYLKASEWGWQIDPLGLRITM
NTIYDRYQKPLFIVENGLGAVDTVEEDGSITDDYRIDYMREHVREMGEAIEDGVELLGYT
PWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSKKKSFDWYKKVIETNGKDID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaaaatttcctaaagactttttatggggcggagcagttgctgccaaccaa
tgtgaaggagcttatcttgaagacggtaaaggactttcacttgttgatatccttccaaca
gtagaggacggacgttgggaagctttattcaatccatcgaaagcgcttgctacagattat
ggtttttacccaagtcacgaatcaattgatttttatcatcgttataaagaagacattaaa
ttaatggctgaaatgggattcaaatgtttccgtatgtccatcagttggccacgtattttc
ccaaatggtgatgaaacgacaccaaatgaaaaaggtttagcattttatgatgcagttttt
gatgaatgtcacaaatatggtatcgaaccagttgttacaatcaaccattttgatactccg
ctagaagttttcaaaaaatatggtggttggaaaaatcgtaaatgcatcgacttttacttg
aatttctgtgaagcaattttcacgcgttataaagataaagtaaaatattggatgacattt
aatgaaattaacatgattcttcatcttccatacattggtggaggtttagacgttactaaa
gaggataatccagaggaagttaaatatcaagctgctcatcatcaattagttgcatcagca
cttgcaactaaacttggtcatgaaatcaatcctgaaaatcaaatcggttgtatgcttgca
gcgggtaacacatatccaatgacttgtaatccaaaagatgtctggaagtctatcgaggcg
gaccgtgaaggctacttcttcattgatgttcaagcacgcggatactacccaagctacact
aaacgtttcttcaaagaacataacatcaacatcaaaatggaagatggcgacttagacgca
ttacgcgatcacacagttgattatgtggcattcagctactattcttctcgtctaacaagc
gcagatccagagaaaaacaaagaaacagaaggcaacgttttcgcaacactaaaaaaccca
tacctaaaagcaagcgaatggggctggcaaattgatccactaggtctacgtattactatg
aatacaatttacgaccgttaccaaaaaccacttttcatcgttgaaaatggcttaggtgca
gtggatactgtggaagaagacggctcaatcactgacgattacagaatcgactacatgcgt
gaacatgttcgcgaaatgggcgaagcaatcgaggacggagtagaacttcttggctataca
ccgtggggctgcatcgatcttgtcagcgctggctctggcgaaatgaaaaaacgctacggc
ttcatctatgttgaccgcgacaacaaaggcaacggaacattaaaccgctcgaagaaaaaa
tcattcgactggtacaaaaaagtaattgaaacaaatggtaaagatatcgactaa

DBGET integrated database retrieval system