KEGG   Listeria monocytogenes 10403S: LMRG_02669Help
Entry
LMRG_02669        CDS       T01984                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lmt00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
251445..252920
Genome map
AA seq 491 aa AA seqDB search
MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES
QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQAIYEPLIQQLLDEGLAYKCYCTEEELDAE
REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE
SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI
FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGEEEIFSKE
EFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVVELSLPHLQKAGVVSAELNQA
ELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAFKK
ELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGREKV
LNRLDTWLKNN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaacaaaacgagtgcgtgtacgttatgcaccaagtccaactggatttttgcat
attgggaatgcacgtactgccttatttaactatttatttgcaagacataatgatggagat
tttatcattcgtattgaagacactgatgctaaacgtaacatagctgacggtgaagaaagt
caaatgacaaatttgaaatggctaggtatggactgggatgaaggcgtggatgttcctgga
aaatacggaccttaccgtcaatcggaacgtcaagccatttatgaaccgttaattcaacaa
cttttggatgaaggtttggcttataaatgttattgcacggaagaagagctggatgctgaa
cgcgaaaaacaaaaagcaaatggtgaaatgcctcgttatagcgggaaatgtcgtcattta
acaaaagagcaacaagcggagaaagaagcgcaaggttttaaaccaagtattcgtttcaaa
gtgccggcaaatgaaacgattactttcaacgatatggtgaaagacgatgtttcgtttgaa
tcaaatggaataggcgattttgttattgcgaaaaaagacggaattccgacttataacttt
gctgtggcagtggatgatcatttaatggaaatttctcatgttcttcgtggggatgaccat
atttcgaatacgcctaaacaaattttgatttataatgcatttggctgggagccaccaatt
tttgggcatatgacacttattgtgaatgagagcagacgtaaattaagtaaacgtgatggt
tcgattattcaatttatcgaacaatatcgcgatttaggatatttaccggaagcattattt
aactttatcgctatgcttggttggtctccagaaggcgaagaagaaattttctctaaagaa
gaattcattaaaatgtttgatccgaagcgtttatctaagtcacccgcattattcgataat
gttaaattgacttgggtgaataaccaatatgtgaaaaaattaccgctaaatgatgtagta
gagctttctttacctcatttacaaaaagcgggtgttgtatctgctgagctaaatcaagct
gaacttgattgggtgcacaaattagtgtcactttatcatgagcaaatgagctatggtgcg
gaaattgtgccactttcagaaatgttctttgcggatgcagagtcaattacgtttgatgaa
gaagagacagcggtgttagcggaagagacagttccaactgttatttcggcattcaaaaaa
gaactagaagcactagaagttcttgaagctgcggaagtaaaagctgcaatcaagcgtgtc
caaaaagaaacgggcgtaaaaggtaaaggtttatttatgccaattcgtattgtgactact
ggtgaaatgcatggtcctgaattgccacttgcaatcgaagttcttggtcgtgaaaaagtg
ctgaatcgtttggacacatggttgaaaaataattaa

DBGET integrated database retrieval system