KEGG   Listeria monocytogenes 10403S: LMRG_02697Help
Entry
LMRG_02697        CDS       T01984                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LMRG_02697
Enzymes [BR:lmt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     LMRG_02697
    3.5.1.-  
     LMRG_02697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2604084..2604716)
Genome map
AA seq 210 aa AA seqDB search
MKIAAFDIDAQKGFTPLCPDELPVSGGDKIVPELNFMASLASLRIGSKDAHPQNAVWVVD
SKDEMLAELEYPNADRTWVRHCEPGTKGFELLDGLPVVTDYDYFIWKGMEPDIHPYGACY
HDIVEHLSTGVLEYLREQKVDLVLVGGLAFDFCVKTTVIQLSRAGFSVLVYLPATRALSE
QGFDETKELLANTEKVQLIETREELVAYCQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgccgcttttgatattgatgcacaaaaaggttttacgccgctttgccccgat
gaattaccggtttcgggtggagataaaattgtgccagaacttaattttatggcaagtctt
gcttctcttcgaattggtagtaaggacgcgcatccgcaaaatgctgtatgggtagtggat
tccaaagacgaaatgctggctgagctcgaatatccaaatgcggaccggacatgggtaagg
cactgtgagcctggtacaaaaggctttgagttattagatggtttgccggttgttactgat
tatgattactttatttggaaaggcatggagccggacattcatccgtatggcgcttgttac
cacgatatcgtcgaacatctttcaacaggtgttctagaatatttgcgggaacaaaaagtc
gatttagttcttgttggaggtttagcttttgatttttgtgtgaaaactacggttatacag
ttaagtagggcaggcttttctgtattagtttatttaccagcgacacgtgcattatctgaa
caaggttttgatgaaacaaaagagctgttagcaaataccgagaaagtgcaacttatcgaa
acaagggaggaacttgtcgcctattgccagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system