KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_0572Help
Entry
LMOSLCC2755_0572  CDS       T02219                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
lmw00340  Histidine metabolism
lmw01100  Metabolic pathways
lmw01110  Biosynthesis of secondary metabolites
lmw01230  Biosynthesis of amino acids
Module
lmw_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    LMOSLCC2755_0572 (hisD)
Enzymes [BR:lmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LMOSLCC2755_0572 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CBY48164
Position
complement(607811..609094)
Genome map
AA seq 427 aa AA seqDB search
MKILTGTVNELLNELKIETDTNTSIQVETEVKTIIEKVKTAGDQALFDFTSKFDGVGLTE
LRVPAADIQAASAKIEPAFLDALQQAKVNIESFHSKQKQHAFLDSEKDGVIRGQLIRPLE
TVGVYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPGENGINPYVLASAQLAGVDEIY
QVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGLVDIDMIAGPSEIVVLADE
NANPAFIAADLLSQAEHDILARAILITTSKKIAEETQNEIDKQLENLPRKAIAQKSIETR
GKIIIAATTQEMFDIMNEIAPEHLEVQLENPMNYLYQIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKEKDAIVLLAKKEGLDAHAKAIQ
IRFEEEN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaaccggaacagtaaatgagctattaaacgagctcaaaatagaaactgat
acgaacacttccatccaggtggaaaccgaagtaaaaacgattatcgaaaaagtcaaaaca
gctggcgaccaagccctatttgacttcacatccaagtttgacggcgtagggctcaccgaa
ctccgcgttccagccgctgacatccaagctgcaagcgcaaaaatcgaacctgccttctta
gacgcgctccaacaagcaaaagtaaatatcgaaagtttccacagcaagcaaaaacaacat
gctttccttgatagtgaaaaagacggcgtcattcgagggcaattaattcgtccactagaa
accgtcggcgtttacgttcccggtggcacagcagcctatccttcatcggttttaatgaat
gtgttgccagccaaaattgccggagtaaagcgaatcgtaatgattacccctcccggtgaa
aacggtattaatccttacgttctagcctcagctcaactagctggtgtggacgaaatttac
caagttggcggtgcacacggaatcgccgctctagctcacggaacagaatctatccctaaa
gtagataaaatcgtcggtcctggaaatatctatgtcgccactgccaaacgtgaagtattc
ggcttagttgatattgacatgatagccggtccatccgaaatcgtcgtgctcgcagatgaa
aacgccaatcctgcttttatcgcagccgacttactctcccaagcagagcacgatatttta
gcccgtgctatcttaatcacaactagtaaaaaaatcgccgaggaaacacaaaatgaaatt
gacaaacagctagaaaatctaccgcgaaaagcgattgctcagaaatctatcgaaacacga
ggaaaaatcattatcgcagcaaccacacaagaaatgttcgatatcatgaacgaaatcgcc
ccagaacacttagaagtacaacttgaaaatccgatgaactatctctatcaaattaaaaac
gctggctccattttcttagggagttatgcatcggaacctcttggcgactattttgctggc
ccaaatcacgtcttacctacaagtggtaccgcaaaattcttctctcctcttggtgttgaa
gattttaccaaacgttccgcctttatttcttatacaaaagaagcactcgcaaaggaaaaa
gatgctatcgttttacttgctaaaaaagaaggtctagacgcccatgccaaagccattcaa
attcgttttgaggaggaaaactaa

DBGET integrated database retrieval system