KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_0985Help
Entry
LMOSLCC2755_0985  CDS       T02219                                 

Gene name
bsaA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LMOSLCC2755_0985 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LMOSLCC2755_0985 (bsaA)
Enzymes [BR:lmw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LMOSLCC2755_0985 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1015097..1015576
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVERFPSKMKPADFEDKVEALVAKVNN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaatggcaaagaaatagctttaagtgat
tataaaggtaaggtattactcatcgtgaatactgcgagtaaatgtggcttaacaccccaa
ttagaaggtctcgaagcaatgtataaaaaattgggtggcgctaattttgaaatcctcggt
ttcccgtgtaaccagtttttgcgacaagatcctggcagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgactttccaaatgttttccaaaattaaagtaaaaggcaaa
gatgccagcccactttataaatatttaaccgaacaaacgggtggtaaaaaagtagaatgg
aactttgcgaaattcttaattgatgaaaatggagaagttgttgaacgtttcccatctaaa
atgaaaccagcagattttgaggataaagtggaagcacttgttgcgaaagtaaataattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system