KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_1193Help
Entry
LMOSLCC2755_1193  CDS       T02219                                 

Gene name
cobA
Definition
uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOSLCC2755_1193 (cobA)
Enzymes [BR:lmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     LMOSLCC2755_1193 (cobA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LMOSLCC2755_1193 (cobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1206228..1207697
Genome map
AA seq 489 aa AA seqDB search
MLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLHHPIP
QEEIEQILVREAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAIGGLA
YAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICANLLEN
GRKAETGVAIVQWASRGKQLTVTGNLQNIEQKVAESGISSPALIVVGDVVSLRPQLNFFE
EMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVVDVVPTKTKEELSEVSELLF
TSKEAVERFFDYLAQLDLDIRSLKNTHLTAIGKQTKEAFSEKGIIPDSFIKRRSTELILE
HLPRLQKNVSNLIIGSIVDTAEVNAILAEVEAMEMMPLYDMRPVTERPFDLASFEQVCFS
SSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSATLASFGINNFIEAESATPESLIELIQ
KTKLEGVPQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgttaattggtgcaggtcctggagatgcacaactgctaaccgtgaaaggtttagctgca
ctacaaaaggcagatgttattgtatacgatcgcctcgttgaaccagcgatgctccaagaa
cgaaaagctagttgtaaactcatttatgtcggaaaagaaccacttcatcatccaattccc
caagaggaaatcgaacaaattcttgttagagaggctgcgacaaatgagctggttgttcgt
ctaaaagcaggagacccttatgtgtttggtcgcggcggggaagaaggagagacactctat
aaagcgggaattccatttgaagttattcctggaatcacatccgcaattggtgggcttgcc
tacgctggaattccagtaacccatcgtgattttgcttcgagttttcacgtgattaccgga
catttgaaaaaaggacgcgatccactagattgggaagcccttgctagactggaaggtacg
ctcgttttcctgatgggaatgactaatttgcctaatatttgtgcgaacttactagaaaat
ggtcgaaaagccgaaacgggtgttgcgattgtacaatgggcatctcgcggcaaacaatta
acggttaccgggaacttacaaaacatcgaacaaaaagtagcggaatctggtatttcttcg
ccggcacttattgttgttggtgatgtggtgagcttacgaccgcagcttaacttctttgag
gaaatgccacttttccatacaaaagtattacttccaagagcacgagctggaaaaagtatg
ctcgcggaacaaattcgcgatttaggcggagaagtaacaatgtatcccaatattcaagta
gtagatgttgtgccaacgaaaacaaaagaagaactaagcgaagtaagcgaacttctcttc
acatccaaagaagcggtagaacgattttttgattatttagcccagcttgatttagatatt
cgttctctaaaaaatacccatcttaccgctattggcaaacaaacaaaagaagcttttagt
gaaaaaggaattattccagatagtttcattaaaaggcggagcacggaattaattttggag
catttaccacggttacagaaaaatgtgagcaacttaattatcggaagcatagttgatacg
gcagaagttaacgcaattttagcagaagtggaagcgatggaaatgatgccgttatatgat
atgcgtcctgtgacagaacgaccatttgaccttgcaagctttgaacaagtttgtttctca
agttcgcgttccgttcaaaatttactcgacgtactaacaaccgaagaaaaagccatttta
caaacgaaaacaattctttccattggaaggttcacgagcgcaacgttagcatcattcggt
atcaacaatttcatcgaagccgaaagcgccacaccagagagcttaattgaactaatccaa
aaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system