KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_1545Help
Entry
LMOSLCC2755_1545  CDS       T02219                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lmw00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1557283..1558776)
Genome map
AA seq 497 aa AA seqDB search
MEKKYILALDQGTTSSRAMIIDEEGEVIGVAQEEFDQIFPKPGWVEHNANEIWASILAVI
AGVLLKTNISSKEIAGIGITNQRETTVIWDKESGNPIYNAIVWQSRQTEDICKQLRKEGY
EDTIRSKTGLLIDPYFAGTKARWILDHVDGAQERAEKGELLFGTIDTWLVWKLTGGRAHI
TDYSNASRTLLYNIYDLEWDDELLKMLNIPKAMLPEVRPSSEVYADTVPYHFFGEEVPVA
GIAGDQQAALFGQGCFEKGMAKNTYGTGCFLLMNTGEKAVRSENGLLTTLAWGIDGKVEY
ALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESSDGVYVVPAFVGLGAPYWDSDV
RGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGISLKTLRVDGGASANNFLMQ
FQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKNEIKKHWKLDKRFEVEMKDEQRE
DLYEGWHKAVKAAQAFK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatatattttagcactggatcaaggaacaacgagttcaagagcgatgatt
attgacgaagaaggagaagtaattggcgttgcacaagaagaatttgatcaaatttttcct
aaaccaggttgggttgaacataatgccaatgaaatctgggcttcgattttagctgttatt
gcaggcgtattactcaaaacaaatatttcttctaaagaaattgctgggattggtattaca
aaccaacgtgaaactactgttatttgggataaagaaagcggaaatccaatttataatgcg
attgtttggcaatctcgtcaaacagaagatatttgtaaacaattacgtaaagaaggctat
gaagataccattcgttctaaaactggtcttttgattgatccgtattttgcgggtacaaaa
gctcgctggattctcgaccatgtagatggtgcgcaagaacgtgctgaaaaaggagaactt
cttttcggaacaatcgatacttggttagtttggaaattaactggtggtcgtgctcatatt
acagattattccaatgcttctcggacacttctttataatatttacgatttagagtgggat
gatgaacttctaaaaatgcttaatatcccaaaagcaatgttacctgaagttcgtccttcc
tctgaagtgtatgcggacacagtgccttatcacttctttggtgaagaagtgccggttgca
ggtattgctggtgaccaacaagccgctttattcggacaaggttgttttgaaaaagggatg
gcgaaaaatacttatggaactggttgtttcttactaatgaacactggggaaaaagcagtc
cgttctgaaaacggcttattaacaacactagcttggggaattgatggaaaagtagaatat
gcacttgaaggtagtatattcgttgctggttcggctattcagtggttacgtgacgggtta
cgaatggttcgtcaatcaagcgattctgaaaactatgcgagccggattgaatctagtgat
ggtgtatatgttgtaccagcattcgttggtttaggcgcaccttactgggattccgatgtt
cgtggtgctgtttttggattaactcgtggtaccgaaaaagaacaatttatccgtgcgaca
ttggaatctcttgcttatcaaacaagagacgtgctttatgcaatggaacaagattctggt
attagcttaaaaacgttacgtgtggatggcggggcttctgctaataacttcttaatgcaa
ttccaatccgatattctaggcgttccggtagaacgtccagaaaacaaagaaacaaccgtt
ctaggtgcggcattcttagctgggcttgcggtaggcgtttggaaagacaaaaacgaaatt
aaaaaacattggaaactagacaaacgttttgaagtagaaatgaaagatgaacaaagagaa
gatttatatgaaggttggcataaagctgtcaaagctgcacaagcctttaaataa

DBGET integrated database retrieval system