KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_1899Help
Entry
LMOSLCC2755_1899  CDS       T02219                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LMOSLCC2755_1899 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2755_1899 (pyrB)
Enzymes [BR:lmw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LMOSLCC2755_1899 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1953473..1954384)
Genome map
AA seq 303 aa AA seqDB search
MKNLLSMEALTVHEIEHLLEQAAQFKRGKKATFNEQTFAVNMFFEPSTRTHTSFEVAEKK
LGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEENYYAGLEKLDIAIVNGG
DGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANSNMKVLKRLGAELFFSGP
REWFDESYLAYGTYLSVDEIVEKVDVLMLLRVQHERHSGTDEFTKESYHEKFGLTENRAK
QLKEDAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVFIRMAILEAILKEQEMRAKL
CTY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgttgtcaatggaagcattaaccgtccatgaaatcgagcatttattagag
caggcggcacagtttaaacgcgggaaaaaagcgacttttaatgaacagactttcgcggtc
aatatgttttttgaaccaagtacgagaacacatacgagttttgaagtagcagagaaaaag
ttaggtgtggaggttgtttcttttgatgcagcgagctctagcatgacaaaaggagaaacg
ctctacgatacactgctcacaatgcaagccgtcggggtcaatgtcgcagtgattagacac
tcagaagaaaattactatgcgggactcgaaaaattagacattgctattgtgaacggcggt
gatggatgcggtgaacatccgagtcaatcactacttgacttatttacaataaaagaacaa
tttggtacttttcagggtttgaaagtagcgattgctggtgatattcgtcacagtcgagtt
gccaattccaatatgaaagtgttaaaaagacttggtgcggaactgtttttctccggaccg
agagaatggttcgacgaaagttacttagcatatggcacttacttatcggttgatgaaatt
gtggaaaaagtggatgtgttgatgcttttgcgtgtacaacatgagcgccatagtggaaca
gatgagtttacgaaagaaagctaccacgaaaaatttggattgacggaaaatcgggcaaag
cagttaaaagaagatgcaatcattatgcacccaagccctgtgaaccgagatgtggaaatt
gctgatagtttagtagaaagcgaaaaatcacgcattgttacgcaaatgacgaatggcgtt
tttataagaatggccattttggaagctattttaaaagaacaggaaatgagggcgaaatta
tgtacgtattaa

DBGET integrated database retrieval system