KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_2157Help
Entry
LMOSLCC2755_2157  CDS       T02219                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
lmw00051  Fructose and mannose metabolism
lmw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LMOSLCC2755_2157
Enzymes [BR:lmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LMOSLCC2755_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CBY49749
Position
complement(2222079..2222729)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKIVKTMFDRFETNAAGGNVSVRMNSEHIIMTPTLMSQAKLCDLSPYEIL
VVDNNNEVVEGDGRVTREINLHRACYVENPKIGCVLHAHPKESMLFATLGMELPNLTEAT
QKIGQIPTLEFAPATSPELAEIVRKHVIELGDKAVPSASLLNKHGIVVLDTSLHKAYDML
ERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagaacgtgaagatttagcaaaaatagtgaagacgatgtttgaccgc
tttgaaacgaatgcagctggaggaaatgtaagtgtgcgcatgaatagtgagcacattatt
atgacacctacactcatgagtcaagcaaaactttgcgatctttccccatatgaaatcctt
gtagtggataataacaatgaagtcgtagaaggagacggaagagttactagagaaattaac
ttacaccgcgcttgttacgtagaaaatccgaaaatcggctgtgtactccatgctcatcca
aaagaatcgatgctatttgccacacttggaatggaattaccgaatttaacagaagcaacg
caaaaaattggccaaattccaacacttgaatttgcgccagcgactagtccagaacttgcg
gaaatcgttcgtaaacacgttatcgaactaggagataaagctgttcctagtgcaagttta
ttaaataaacacggtattgtcgtattagatacatcacttcataaagcatacgacatgcta
gagcgtattgaatacaatgcctatattgcagaaaaagcgttagtatttgatgcgttaggt
ataaaaaaattagctcatgaccgcgaattaaattataatttggaggagtaa

DBGET integrated database retrieval system