KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_2461Help
Entry
LMOSLCC2755_2461  CDS       T02219                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOSLCC2755_2461 (tpi)
   01230 Biosynthesis of amino acids
    LMOSLCC2755_2461 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2755_2461 (tpi)
   00051 Fructose and mannose metabolism
    LMOSLCC2755_2461 (tpi)
   00562 Inositol phosphate metabolism
    LMOSLCC2755_2461 (tpi)
Enzymes [BR:lmw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC2755_2461 (tpi)
Exosome [BR:lmw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC2755_2461 (tpi)
  Exosomal proteins of bladder cancer cells
   LMOSLCC2755_2461 (tpi)
  Exosomal proteins of melanoma cells
   LMOSLCC2755_2461 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2540502..2541257)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VAAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggcgctatttttacaagaattagttcgtcttactgaaggaactaatcttcgc
gtagctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgatttaggtgtttcttatgttattatcggacactctgaacgtcgtgag
tatttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttccacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgcagacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system