KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_2552Help
Entry
LMOSLCC2755_2552  CDS       T02219                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
lmw00260  Glycine, serine and threonine metabolism
lmw00750  Vitamin B6 metabolism
lmw01100  Metabolic pathways
lmw01110  Biosynthesis of secondary metabolites
lmw01120  Microbial metabolism in diverse environments
lmw01230  Biosynthesis of amino acids
Module
lmw_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC2755_2552 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMOSLCC2755_2552 (thrC)
Enzymes [BR:lmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMOSLCC2755_2552 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-ProteinID: CBY50144
Position
complement(2633386..2634441)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWELAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacacca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
ctgggtgttactttatacggaaaatatgaaggcttaaatccaaccggttcttttaaagac
cgtggaatggttatggctgttgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tacggcgcagatattatctcaattcaaggtaattttgatgaagcgttaaaatcggttcgt
gaactggctgaaacagaagcagtaacgcttgtaaactcggtaaatccttatcgtttagaa
ggtcaaaaaacagctgcattcgaaatttgtgagcaattaggttctgctccagatgtcctt
gcaatcccagtaggtaatgccggaaacatttctgcctactggaaagggtttaaagaatgg
aatgaggccaaggcttctggacttccacggatgcatggttttgaagcggaaggtgcggct
gcgattgttcaaggtaaaccgattgataatccggaaacaattgcaacggcgattcgtatc
ggaaatccagctagttgggagcttgcagaagcagctcgcgatgaatctggcggatatatc
cattctgtaacagatgatgaaattgtaaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccaggttcagccgcttcattagctggtgtcatccaacatgtagcaaat
ggaacaattaaaaaaggcgaaacagtagtttgtgtctttactggaaacggcttgaaagat
ccggatactgcgatgagtgtgcatgaaattccgatttctcatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system