KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_0191Help
Entry
LMOSLCC2372_0191  CDS       T02220                                 

Gene name
ispE
Definition
4-(cytidine 5-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lmx00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
193941..194822
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFAATGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggatggctatcatgaagtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaagcgcactttatt
ccagaagatcgtcgcaatttaatttatcaagcggccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcatattcctgtttctgcgggacttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcagaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactggacgcggggagaaaatttctgcgttacctaat
attcctggttgttggattgtacttgctaagccgagcattagcgtgtcaacacccactatc
tataaagaacttcaagtagacaatgtagaacacccagacacacaaaaaatgattgaatcc
atcaaaaatggtgatctagacgggatttttgcggctacagggaatgtgctagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggctctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaattattaa

DBGET integrated database retrieval system